Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
| Location | 2369952..2370173 | Replicon | chromosome |
| Accession | NZ_CP034808 | ||
| Organism | Escherichia coli strain 08-3914 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | AYP36_RS11295 | Protein ID | WP_001295224.1 |
| Coordinates | 2370066..2370173 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2369952..2370017 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYP36_RS11275 | 2365392..2366294 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| AYP36_RS11280 | 2366305..2367288 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| AYP36_RS11285 | 2367285..2368289 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| AYP36_RS11290 | 2368319..2369590 | - | 1272 | WP_001301684.1 | amino acid permease | - |
| - | 2369952..2370017 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 2369952..2370017 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 2369952..2370017 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 2369952..2370017 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 2369952..2370017 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 2369952..2370017 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 2369952..2370017 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 2369952..2370017 | - | 66 | NuclAT_21 | - | Antitoxin |
| AYP36_RS11295 | 2370066..2370173 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| AYP36_RS11300 | 2370260..2371939 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| AYP36_RS11305 | 2371936..2372127 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| AYP36_RS11310 | 2372124..2373695 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| AYP36_RS11315 | 2373967..2374155 | + | 189 | WP_001063316.1 | YhjR family protein | - |
| AYP36_RS11320 | 2374167..2374364 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
| AYP36_RS11325 | 2374383..2374919 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T116840 WP_001295224.1 NZ_CP034808:2370066-2370173 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T116840 NZ_CP034808:2370066-2370173 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT116840 NZ_CP034808:c2370017-2369952 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|