Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 145252..145477 | Replicon | chromosome |
Accession | NZ_CP034808 | ||
Organism | Escherichia coli strain 08-3914 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | AYP36_RS00740 | Protein ID | WP_000813263.1 |
Coordinates | 145252..145407 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 145419..145477 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYP36_RS00705 | 140706..141419 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
AYP36_RS00710 | 141557..141753 | - | 197 | Protein_129 | TrmB family transcriptional regulator | - |
AYP36_RS00715 | 142040..142858 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
AYP36_RS00720 | 143010..143381 | - | 372 | WP_000090264.1 | antitermination protein | - |
AYP36_RS00725 | 143371..143742 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
AYP36_RS00730 | 143755..144804 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
AYP36_RS00735 | 144806..145084 | - | 279 | WP_001341388.1 | hypothetical protein | - |
AYP36_RS00740 | 145252..145407 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 145419..145477 | + | 59 | - | - | Antitoxin |
AYP36_RS00755 | 146012..146785 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
AYP36_RS00760 | 147137..147550 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
AYP36_RS00765 | 147566..148336 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
AYP36_RS00770 | 148358..149104 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
AYP36_RS00775 | 149111..150202 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T116828 WP_000813263.1 NZ_CP034808:c145407-145252 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T116828 NZ_CP034808:c145407-145252 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT116828 NZ_CP034808:145419-145477 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|