Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 4914406..4914627 | Replicon | chromosome |
| Accession | NZ_CP034806 | ||
| Organism | Escherichia coli strain 2010C-3347 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | A1D75_RS25475 | Protein ID | WP_001295224.1 |
| Coordinates | 4914406..4914513 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 4914562..4914627 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A1D75_RS25450 | 4909659..4910411 | - | 753 | Protein_4837 | cellulose biosynthesis protein BcsQ | - |
| A1D75_RS25455 | 4910423..4910611 | - | 189 | WP_001063316.1 | YhjR family protein | - |
| A1D75_RS25460 | 4910884..4912455 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| A1D75_RS25465 | 4912452..4912643 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| A1D75_RS25470 | 4912640..4914319 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| A1D75_RS25475 | 4914406..4914513 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4914562..4914627 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 4914562..4914627 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 4914562..4914627 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 4914562..4914627 | + | 66 | NuclAT_17 | - | Antitoxin |
| - | 4914562..4914627 | + | 66 | NuclAT_22 | - | Antitoxin |
| - | 4914562..4914627 | + | 66 | NuclAT_22 | - | Antitoxin |
| - | 4914562..4914627 | + | 66 | NuclAT_22 | - | Antitoxin |
| - | 4914562..4914627 | + | 66 | NuclAT_22 | - | Antitoxin |
| A1D75_RS25480 | 4914989..4916254 | + | 1266 | WP_001481782.1 | amino acid permease | - |
| A1D75_RS25485 | 4916284..4917288 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| A1D75_RS25490 | 4917285..4918268 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| A1D75_RS25495 | 4918279..4919181 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T116824 WP_001295224.1 NZ_CP034806:c4914513-4914406 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T116824 NZ_CP034806:c4914513-4914406 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT116824 NZ_CP034806:4914562-4914627 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|