Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 65459..65723 | Replicon | plasmid p2009C-3554-1 |
Accession | NZ_CP034804 | ||
Organism | Escherichia coli strain 2009C-3554 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | A0I22_RS28575 | Protein ID | WP_001331364.1 |
Coordinates | 65571..65723 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 65459..65521 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A0I22_RS28560 | 60698..62989 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
A0I22_RS28565 | 62982..64052 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
A0I22_RS28570 | 64071..65279 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 65459..65521 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 65459..65521 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 65459..65521 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 65459..65521 | - | 63 | NuclAT_0 | - | Antitoxin |
A0I22_RS28575 | 65571..65723 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
A0I22_RS28580 | 65795..66046 | - | 252 | WP_001291964.1 | hypothetical protein | - |
A0I22_RS29390 | 66705..66881 | - | 177 | WP_001054897.1 | hypothetical protein | - |
A0I22_RS28585 | 67273..67482 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
A0I22_RS28590 | 67554..68204 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
A0I22_RS28595 | 68278..70446 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..83424 | 83424 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T116787 WP_001331364.1 NZ_CP034804:65571-65723 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T116787 NZ_CP034804:65571-65723 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT116787 NZ_CP034804:c65521-65459 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|