Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4761673..4761898 | Replicon | chromosome |
| Accession | NZ_CP034801 | ||
| Organism | Escherichia coli strain 2010C-3142 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | AYR10_RS23965 | Protein ID | WP_000813258.1 |
| Coordinates | 4761743..4761898 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4761673..4761731 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYR10_RS23925 | 4757875..4758501 | + | 627 | WP_127821357.1 | prepilin peptidase | - |
| AYR10_RS23930 | 4758494..4758955 | + | 462 | WP_000139447.1 | replication protein | - |
| AYR10_RS23935 | 4758989..4759705 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| AYR10_RS23940 | 4759738..4760019 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| AYR10_RS23945 | 4760016..4760243 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| AYR10_RS23950 | 4760236..4760547 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| AYR10_RS23955 | 4760675..4760893 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| AYR10_RS23960 | 4760895..4761452 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 4761673..4761731 | - | 59 | - | - | Antitoxin |
| AYR10_RS23965 | 4761743..4761898 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AYR10_RS23970 | 4762018..4762362 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| AYR10_RS23975 | 4762484..4762756 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| AYR10_RS23980 | 4762758..4763807 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| AYR10_RS23985 | 4763820..4764125 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYR10_RS23990 | 4764188..4764742 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| AYR10_RS23995 | 4764967..4765164 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| AYR10_RS24000 | 4765300..4766013 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| AYR10_RS24015 | 4766464..4766895 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 4698564..4799251 | 100687 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T116748 WP_000813258.1 NZ_CP034801:4761743-4761898 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T116748 NZ_CP034801:4761743-4761898 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT116748 NZ_CP034801:c4761731-4761673 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|