Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 158744..158969 | Replicon | chromosome |
| Accession | NZ_CP034801 | ||
| Organism | Escherichia coli strain 2010C-3142 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | AYR10_RS00850 | Protein ID | WP_000813263.1 |
| Coordinates | 158744..158899 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 158911..158969 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYR10_RS00815 | 154198..154911 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| AYR10_RS00820 | 155049..155245 | - | 197 | Protein_146 | TrmB family transcriptional regulator | - |
| AYR10_RS00825 | 155532..156350 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| AYR10_RS00830 | 156502..156873 | - | 372 | WP_000090264.1 | antitermination protein | - |
| AYR10_RS00835 | 156863..157234 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYR10_RS00840 | 157247..158296 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| AYR10_RS00845 | 158298..158576 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| AYR10_RS00850 | 158744..158899 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 158911..158969 | + | 59 | - | - | Antitoxin |
| AYR10_RS00865 | 159504..160277 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| AYR10_RS00870 | 160629..161042 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| AYR10_RS00875 | 161058..161828 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| AYR10_RS00880 | 161850..162596 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
| AYR10_RS00885 | 162603..163694 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T116718 WP_000813263.1 NZ_CP034801:c158899-158744 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T116718 NZ_CP034801:c158899-158744 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT116718 NZ_CP034801:158911-158969 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|