Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4768433..4768658 | Replicon | chromosome |
Accession | NZ_CP034799 | ||
Organism | Escherichia coli strain 2009C-4687 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | A0I37_RS24030 | Protein ID | WP_000813258.1 |
Coordinates | 4768503..4768658 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4768433..4768491 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A0I37_RS23980 | 4763500..4763741 | + | 242 | Protein_4546 | hypothetical protein | - |
A0I37_RS23985 | 4763725..4764150 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
A0I37_RS23990 | 4764219..4765715 | + | 1497 | WP_164848195.1 | replication 14 domain protein | - |
A0I37_RS24000 | 4765749..4766465 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
A0I37_RS24005 | 4766498..4766779 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
A0I37_RS24010 | 4766776..4767003 | + | 228 | WP_000699809.1 | hypothetical protein | - |
A0I37_RS24015 | 4766996..4767307 | + | 312 | WP_001289673.1 | hypothetical protein | - |
A0I37_RS24020 | 4767435..4767653 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
A0I37_RS24025 | 4767655..4768212 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 4768433..4768491 | - | 59 | - | - | Antitoxin |
A0I37_RS24030 | 4768503..4768658 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
A0I37_RS24035 | 4768778..4769122 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
A0I37_RS24040 | 4769244..4769516 | + | 273 | WP_000191872.1 | hypothetical protein | - |
A0I37_RS24045 | 4769518..4770567 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
A0I37_RS24050 | 4770580..4770885 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
A0I37_RS24055 | 4770948..4771502 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
A0I37_RS24060 | 4771727..4771924 | + | 198 | WP_000917763.1 | hypothetical protein | - |
A0I37_RS24065 | 4772060..4772773 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
A0I37_RS24080 | 4773224..4773655 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 4694922..4816796 | 121874 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T116713 WP_000813258.1 NZ_CP034799:4768503-4768658 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T116713 NZ_CP034799:4768503-4768658 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT116713 NZ_CP034799:c4768491-4768433 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|