Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 165542..165767 | Replicon | chromosome |
| Accession | NZ_CP034799 | ||
| Organism | Escherichia coli strain 2009C-4687 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | A0I37_RS00910 | Protein ID | WP_000813263.1 |
| Coordinates | 165542..165697 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 165709..165767 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A0I37_RS00875 | 160996..161709 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| A0I37_RS00880 | 161847..162043 | - | 197 | Protein_154 | TrmB family transcriptional regulator | - |
| A0I37_RS00885 | 162330..163148 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| A0I37_RS00890 | 163300..163671 | - | 372 | WP_000090264.1 | antitermination protein | - |
| A0I37_RS00895 | 163661..164032 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A0I37_RS00900 | 164045..165094 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| A0I37_RS00905 | 165096..165374 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| A0I37_RS00910 | 165542..165697 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 165709..165767 | + | 59 | - | - | Antitoxin |
| A0I37_RS00925 | 166302..167075 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| A0I37_RS00930 | 167427..167840 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| A0I37_RS00935 | 167856..168626 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| A0I37_RS00940 | 168648..169394 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
| A0I37_RS00945 | 169401..170492 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T116683 WP_000813263.1 NZ_CP034799:c165697-165542 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T116683 NZ_CP034799:c165697-165542 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT116683 NZ_CP034799:165709-165767 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|