Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1455284..1455498 Replicon chromosome
Accession NZ_CP034794
Organism Escherichia coli strain 06-3462

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag A1D74_RS07510 Protein ID WP_000170963.1
Coordinates 1455284..1455391 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1455439..1455498 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A1D74_RS07480 1450593..1451675 + 1083 WP_000804726.1 peptide chain release factor 1 -
A1D74_RS07485 1451675..1452508 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
A1D74_RS07490 1452505..1452897 + 393 WP_000200379.1 invasion regulator SirB2 -
A1D74_RS07495 1452901..1453710 + 810 WP_001257044.1 invasion regulator SirB1 -
A1D74_RS07500 1453746..1454600 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
A1D74_RS07505 1454748..1454855 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1454908..1454969 + 62 NuclAT_24 - -
- 1454908..1454969 + 62 NuclAT_24 - -
- 1454908..1454969 + 62 NuclAT_24 - -
- 1454908..1454969 + 62 NuclAT_24 - -
- 1454908..1454969 + 62 NuclAT_26 - -
- 1454908..1454969 + 62 NuclAT_26 - -
- 1454908..1454969 + 62 NuclAT_26 - -
- 1454908..1454969 + 62 NuclAT_26 - -
- 1454908..1454969 + 62 NuclAT_28 - -
- 1454908..1454969 + 62 NuclAT_28 - -
- 1454908..1454969 + 62 NuclAT_28 - -
- 1454908..1454969 + 62 NuclAT_28 - -
- 1454908..1454969 + 62 NuclAT_30 - -
- 1454908..1454969 + 62 NuclAT_30 - -
- 1454908..1454969 + 62 NuclAT_30 - -
- 1454908..1454969 + 62 NuclAT_30 - -
- 1454908..1454969 + 62 NuclAT_32 - -
- 1454908..1454969 + 62 NuclAT_32 - -
- 1454908..1454969 + 62 NuclAT_32 - -
- 1454908..1454969 + 62 NuclAT_32 - -
- 1454908..1454970 + 63 NuclAT_17 - -
- 1454908..1454970 + 63 NuclAT_17 - -
- 1454908..1454970 + 63 NuclAT_17 - -
- 1454908..1454970 + 63 NuclAT_17 - -
- 1454908..1454970 + 63 NuclAT_18 - -
- 1454908..1454970 + 63 NuclAT_18 - -
- 1454908..1454970 + 63 NuclAT_18 - -
- 1454908..1454970 + 63 NuclAT_18 - -
- 1454908..1454970 + 63 NuclAT_19 - -
- 1454908..1454970 + 63 NuclAT_19 - -
- 1454908..1454970 + 63 NuclAT_19 - -
- 1454908..1454970 + 63 NuclAT_19 - -
- 1454908..1454970 + 63 NuclAT_20 - -
- 1454908..1454970 + 63 NuclAT_20 - -
- 1454908..1454970 + 63 NuclAT_20 - -
- 1454908..1454970 + 63 NuclAT_20 - -
- 1454908..1454970 + 63 NuclAT_22 - -
- 1454908..1454970 + 63 NuclAT_22 - -
- 1454908..1454970 + 63 NuclAT_22 - -
- 1454908..1454970 + 63 NuclAT_22 - -
- 1454908..1454970 + 63 NuclAT_23 - -
- 1454908..1454970 + 63 NuclAT_23 - -
- 1454908..1454970 + 63 NuclAT_23 - -
- 1454908..1454970 + 63 NuclAT_23 - -
A1D74_RS07510 1455284..1455391 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1455439..1455498 + 60 NuclAT_25 - Antitoxin
- 1455439..1455498 + 60 NuclAT_25 - Antitoxin
- 1455439..1455498 + 60 NuclAT_25 - Antitoxin
- 1455439..1455498 + 60 NuclAT_25 - Antitoxin
- 1455439..1455498 + 60 NuclAT_27 - Antitoxin
- 1455439..1455498 + 60 NuclAT_27 - Antitoxin
- 1455439..1455498 + 60 NuclAT_27 - Antitoxin
- 1455439..1455498 + 60 NuclAT_27 - Antitoxin
- 1455439..1455498 + 60 NuclAT_29 - Antitoxin
- 1455439..1455498 + 60 NuclAT_29 - Antitoxin
- 1455439..1455498 + 60 NuclAT_29 - Antitoxin
- 1455439..1455498 + 60 NuclAT_29 - Antitoxin
- 1455439..1455498 + 60 NuclAT_31 - Antitoxin
- 1455439..1455498 + 60 NuclAT_31 - Antitoxin
- 1455439..1455498 + 60 NuclAT_31 - Antitoxin
- 1455439..1455498 + 60 NuclAT_31 - Antitoxin
- 1455439..1455498 + 60 NuclAT_33 - Antitoxin
- 1455439..1455498 + 60 NuclAT_33 - Antitoxin
- 1455439..1455498 + 60 NuclAT_33 - Antitoxin
- 1455439..1455498 + 60 NuclAT_33 - Antitoxin
A1D74_RS07515 1455790..1456890 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
A1D74_RS07520 1457160..1457390 + 231 WP_001146444.1 putative cation transport regulator ChaB -
A1D74_RS07525 1457551..1458246 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
A1D74_RS07530 1458290..1458643 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
A1D74_RS07535 1458829..1460223 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T116610 WP_000170963.1 NZ_CP034794:c1455391-1455284 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T116610 NZ_CP034794:c1455391-1455284 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT116610 NZ_CP034794:1455439-1455498 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References