Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1731844..1732069 | Replicon | chromosome |
Accession | NZ_CP034792 | ||
Organism | Escherichia coli strain 2009C-3378 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | DR788_RS09210 | Protein ID | WP_000813258.1 |
Coordinates | 1731914..1732069 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1731844..1731902 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DR788_RS09160 | 1726909..1727151 | + | 243 | WP_000747948.1 | hypothetical protein | - |
DR788_RS09165 | 1727135..1727560 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
DR788_RS09170 | 1727629..1728672 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
DR788_RS09175 | 1728665..1729126 | + | 462 | WP_000139447.1 | replication protein | - |
DR788_RS09180 | 1729160..1729876 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
DR788_RS09185 | 1729909..1730190 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
DR788_RS09190 | 1730187..1730414 | + | 228 | WP_000699809.1 | hypothetical protein | - |
DR788_RS09195 | 1730407..1730718 | + | 312 | WP_001289673.1 | hypothetical protein | - |
DR788_RS09200 | 1730846..1731064 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
DR788_RS09205 | 1731066..1731623 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 1731844..1731902 | - | 59 | - | - | Antitoxin |
DR788_RS09210 | 1731914..1732069 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DR788_RS09215 | 1732189..1732533 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
DR788_RS09220 | 1732655..1732927 | + | 273 | WP_000191872.1 | hypothetical protein | - |
DR788_RS09225 | 1732929..1733978 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
DR788_RS09230 | 1733991..1734296 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
DR788_RS09235 | 1734359..1734913 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
DR788_RS09240 | 1735138..1735335 | + | 198 | WP_000917763.1 | hypothetical protein | - |
DR788_RS09245 | 1735471..1736184 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
DR788_RS09260 | 1736635..1737066 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 1671178..1769418 | 98240 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T116581 WP_000813258.1 NZ_CP034792:1731914-1732069 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T116581 NZ_CP034792:1731914-1732069 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT116581 NZ_CP034792:c1731902-1731844 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|