Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1238009..1238231 | Replicon | chromosome |
Accession | NZ_CP034658 | ||
Organism | Escherichia coli strain ATCC 98082 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | D3H2K1 |
Locus tag | EKH78_RS05990 | Protein ID | WP_000170955.1 |
Coordinates | 1238009..1238116 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1238164..1238231 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EKH78_RS05960 (1233865) | 1233865..1234698 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
EKH78_RS05965 (1234695) | 1234695..1235087 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
EKH78_RS05970 (1235091) | 1235091..1235900 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
EKH78_RS05975 (1235936) | 1235936..1236790 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
EKH78_RS05980 (1236939) | 1236939..1237046 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_34 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_34 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_34 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_34 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_36 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_36 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_36 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_36 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_38 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_38 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_38 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_38 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_40 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_40 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_40 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_40 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_42 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_42 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_42 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_42 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_44 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_44 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_44 | - | - |
- (1237094) | 1237094..1237160 | + | 67 | NuclAT_44 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_18 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_18 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_18 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_18 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_21 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_21 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_21 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_21 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_24 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_24 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_24 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_24 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_27 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_27 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_27 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_27 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_30 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_30 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_30 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_30 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_33 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_33 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_33 | - | - |
- (1237096) | 1237096..1237161 | + | 66 | NuclAT_33 | - | - |
EKH78_RS05985 (1237474) | 1237474..1237581 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_35 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_35 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_35 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_35 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_37 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_37 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_37 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_37 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_39 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_39 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_39 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_39 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_41 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_41 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_41 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_41 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_43 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_43 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_43 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_43 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_45 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_45 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_45 | - | - |
- (1237630) | 1237630..1237695 | + | 66 | NuclAT_45 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_17 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_17 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_17 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_17 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_20 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_20 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_20 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_20 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_23 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_23 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_23 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_23 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_26 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_26 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_26 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_26 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_29 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_29 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_29 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_29 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_32 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_32 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_32 | - | - |
- (1237629) | 1237629..1237696 | + | 68 | NuclAT_32 | - | - |
EKH78_RS05990 (1238009) | 1238009..1238116 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_16 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_16 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_16 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_16 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_19 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_19 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_19 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_19 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_22 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_22 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_22 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_22 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_25 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_25 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_25 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_25 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_28 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_28 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_28 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_28 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_31 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_31 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_31 | - | Antitoxin |
- (1238164) | 1238164..1238231 | + | 68 | NuclAT_31 | - | Antitoxin |
EKH78_RS05995 (1238520) | 1238520..1239620 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
EKH78_RS06000 (1239890) | 1239890..1240120 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
EKH78_RS06005 (1240278) | 1240278..1240973 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
EKH78_RS06010 (1241017) | 1241017..1241370 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
EKH78_RS06015 (1241555) | 1241555..1242949 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T116305 WP_000170955.1 NZ_CP034658:c1238116-1238009 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T116305 NZ_CP034658:c1238116-1238009 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT116305 NZ_CP034658:1238164-1238231 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|