Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1237474..1237696 Replicon chromosome
Accession NZ_CP034658
Organism Escherichia coli strain ATCC 98082

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag EKH78_RS05985 Protein ID WP_000170963.1
Coordinates 1237474..1237581 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1237629..1237696 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EKH78_RS05955 (1232783) 1232783..1233865 + 1083 WP_000804726.1 peptide chain release factor 1 -
EKH78_RS05960 (1233865) 1233865..1234698 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
EKH78_RS05965 (1234695) 1234695..1235087 + 393 WP_000200374.1 invasion regulator SirB2 -
EKH78_RS05970 (1235091) 1235091..1235900 + 810 WP_001257044.1 invasion regulator SirB1 -
EKH78_RS05975 (1235936) 1235936..1236790 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
EKH78_RS05980 (1236939) 1236939..1237046 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1237094) 1237094..1237160 + 67 NuclAT_34 - -
- (1237094) 1237094..1237160 + 67 NuclAT_34 - -
- (1237094) 1237094..1237160 + 67 NuclAT_34 - -
- (1237094) 1237094..1237160 + 67 NuclAT_34 - -
- (1237094) 1237094..1237160 + 67 NuclAT_36 - -
- (1237094) 1237094..1237160 + 67 NuclAT_36 - -
- (1237094) 1237094..1237160 + 67 NuclAT_36 - -
- (1237094) 1237094..1237160 + 67 NuclAT_36 - -
- (1237094) 1237094..1237160 + 67 NuclAT_38 - -
- (1237094) 1237094..1237160 + 67 NuclAT_38 - -
- (1237094) 1237094..1237160 + 67 NuclAT_38 - -
- (1237094) 1237094..1237160 + 67 NuclAT_38 - -
- (1237094) 1237094..1237160 + 67 NuclAT_40 - -
- (1237094) 1237094..1237160 + 67 NuclAT_40 - -
- (1237094) 1237094..1237160 + 67 NuclAT_40 - -
- (1237094) 1237094..1237160 + 67 NuclAT_40 - -
- (1237094) 1237094..1237160 + 67 NuclAT_42 - -
- (1237094) 1237094..1237160 + 67 NuclAT_42 - -
- (1237094) 1237094..1237160 + 67 NuclAT_42 - -
- (1237094) 1237094..1237160 + 67 NuclAT_42 - -
- (1237094) 1237094..1237160 + 67 NuclAT_44 - -
- (1237094) 1237094..1237160 + 67 NuclAT_44 - -
- (1237094) 1237094..1237160 + 67 NuclAT_44 - -
- (1237094) 1237094..1237160 + 67 NuclAT_44 - -
- (1237096) 1237096..1237161 + 66 NuclAT_18 - -
- (1237096) 1237096..1237161 + 66 NuclAT_18 - -
- (1237096) 1237096..1237161 + 66 NuclAT_18 - -
- (1237096) 1237096..1237161 + 66 NuclAT_18 - -
- (1237096) 1237096..1237161 + 66 NuclAT_21 - -
- (1237096) 1237096..1237161 + 66 NuclAT_21 - -
- (1237096) 1237096..1237161 + 66 NuclAT_21 - -
- (1237096) 1237096..1237161 + 66 NuclAT_21 - -
- (1237096) 1237096..1237161 + 66 NuclAT_24 - -
- (1237096) 1237096..1237161 + 66 NuclAT_24 - -
- (1237096) 1237096..1237161 + 66 NuclAT_24 - -
- (1237096) 1237096..1237161 + 66 NuclAT_24 - -
- (1237096) 1237096..1237161 + 66 NuclAT_27 - -
- (1237096) 1237096..1237161 + 66 NuclAT_27 - -
- (1237096) 1237096..1237161 + 66 NuclAT_27 - -
- (1237096) 1237096..1237161 + 66 NuclAT_27 - -
- (1237096) 1237096..1237161 + 66 NuclAT_30 - -
- (1237096) 1237096..1237161 + 66 NuclAT_30 - -
- (1237096) 1237096..1237161 + 66 NuclAT_30 - -
- (1237096) 1237096..1237161 + 66 NuclAT_30 - -
- (1237096) 1237096..1237161 + 66 NuclAT_33 - -
- (1237096) 1237096..1237161 + 66 NuclAT_33 - -
- (1237096) 1237096..1237161 + 66 NuclAT_33 - -
- (1237096) 1237096..1237161 + 66 NuclAT_33 - -
EKH78_RS05985 (1237474) 1237474..1237581 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1237630) 1237630..1237695 + 66 NuclAT_35 - -
- (1237630) 1237630..1237695 + 66 NuclAT_35 - -
- (1237630) 1237630..1237695 + 66 NuclAT_35 - -
- (1237630) 1237630..1237695 + 66 NuclAT_35 - -
- (1237630) 1237630..1237695 + 66 NuclAT_37 - -
- (1237630) 1237630..1237695 + 66 NuclAT_37 - -
- (1237630) 1237630..1237695 + 66 NuclAT_37 - -
- (1237630) 1237630..1237695 + 66 NuclAT_37 - -
- (1237630) 1237630..1237695 + 66 NuclAT_39 - -
- (1237630) 1237630..1237695 + 66 NuclAT_39 - -
- (1237630) 1237630..1237695 + 66 NuclAT_39 - -
- (1237630) 1237630..1237695 + 66 NuclAT_39 - -
- (1237630) 1237630..1237695 + 66 NuclAT_41 - -
- (1237630) 1237630..1237695 + 66 NuclAT_41 - -
- (1237630) 1237630..1237695 + 66 NuclAT_41 - -
- (1237630) 1237630..1237695 + 66 NuclAT_41 - -
- (1237630) 1237630..1237695 + 66 NuclAT_43 - -
- (1237630) 1237630..1237695 + 66 NuclAT_43 - -
- (1237630) 1237630..1237695 + 66 NuclAT_43 - -
- (1237630) 1237630..1237695 + 66 NuclAT_43 - -
- (1237630) 1237630..1237695 + 66 NuclAT_45 - -
- (1237630) 1237630..1237695 + 66 NuclAT_45 - -
- (1237630) 1237630..1237695 + 66 NuclAT_45 - -
- (1237630) 1237630..1237695 + 66 NuclAT_45 - -
- (1237629) 1237629..1237696 + 68 NuclAT_17 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_17 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_17 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_17 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_20 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_20 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_20 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_20 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_23 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_23 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_23 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_23 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_26 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_26 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_26 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_26 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_29 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_29 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_29 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_29 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_32 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_32 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_32 - Antitoxin
- (1237629) 1237629..1237696 + 68 NuclAT_32 - Antitoxin
EKH78_RS05990 (1238009) 1238009..1238116 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1238164) 1238164..1238231 + 68 NuclAT_16 - -
- (1238164) 1238164..1238231 + 68 NuclAT_16 - -
- (1238164) 1238164..1238231 + 68 NuclAT_16 - -
- (1238164) 1238164..1238231 + 68 NuclAT_16 - -
- (1238164) 1238164..1238231 + 68 NuclAT_19 - -
- (1238164) 1238164..1238231 + 68 NuclAT_19 - -
- (1238164) 1238164..1238231 + 68 NuclAT_19 - -
- (1238164) 1238164..1238231 + 68 NuclAT_19 - -
- (1238164) 1238164..1238231 + 68 NuclAT_22 - -
- (1238164) 1238164..1238231 + 68 NuclAT_22 - -
- (1238164) 1238164..1238231 + 68 NuclAT_22 - -
- (1238164) 1238164..1238231 + 68 NuclAT_22 - -
- (1238164) 1238164..1238231 + 68 NuclAT_25 - -
- (1238164) 1238164..1238231 + 68 NuclAT_25 - -
- (1238164) 1238164..1238231 + 68 NuclAT_25 - -
- (1238164) 1238164..1238231 + 68 NuclAT_25 - -
- (1238164) 1238164..1238231 + 68 NuclAT_28 - -
- (1238164) 1238164..1238231 + 68 NuclAT_28 - -
- (1238164) 1238164..1238231 + 68 NuclAT_28 - -
- (1238164) 1238164..1238231 + 68 NuclAT_28 - -
- (1238164) 1238164..1238231 + 68 NuclAT_31 - -
- (1238164) 1238164..1238231 + 68 NuclAT_31 - -
- (1238164) 1238164..1238231 + 68 NuclAT_31 - -
- (1238164) 1238164..1238231 + 68 NuclAT_31 - -
EKH78_RS05995 (1238520) 1238520..1239620 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
EKH78_RS06000 (1239890) 1239890..1240120 + 231 WP_001146444.1 putative cation transport regulator ChaB -
EKH78_RS06005 (1240278) 1240278..1240973 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
EKH78_RS06010 (1241017) 1241017..1241370 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T116302 WP_000170963.1 NZ_CP034658:c1237581-1237474 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T116302 NZ_CP034658:c1237581-1237474 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT116302 NZ_CP034658:1237629-1237696 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References