Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48091..48361 | Replicon | plasmid pL37-4 |
| Accession | NZ_CP034592 | ||
| Organism | Escherichia coli strain L37 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | EKM58_RS23535 | Protein ID | WP_001312861.1 |
| Coordinates | 48203..48361 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 48091..48154 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EKM58_RS23510 | 43802..44329 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| EKM58_RS23515 | 44387..44620 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| EKM58_RS23520 | 44681..46704 | + | 2024 | Protein_46 | ParB/RepB/Spo0J family partition protein | - |
| EKM58_RS23525 | 46773..47207 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| EKM58_RS23530 | 47204..47923 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 47935..48159 | + | 225 | NuclAT_0 | - | - |
| - | 47935..48159 | + | 225 | NuclAT_0 | - | - |
| - | 47935..48159 | + | 225 | NuclAT_0 | - | - |
| - | 47935..48159 | + | 225 | NuclAT_0 | - | - |
| EKM58_RS23920 | 47944..48123 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 48091..48154 | - | 64 | - | - | Antitoxin |
| EKM58_RS23535 | 48203..48361 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| EKM58_RS24025 | 48599..48976 | - | 378 | Protein_51 | hypothetical protein | - |
| EKM58_RS23555 | 49276..49572 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| EKM58_RS23560 | 49683..50504 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| EKM58_RS23565 | 50801..51448 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| EKM58_RS23570 | 51725..52108 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| EKM58_RS23575 | 52299..52985 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| EKM58_RS23580 | 53079..53306 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | fosA3 / blaTEM-1B / blaCTX-M-55 | - | 1..76559 | 76559 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T116252 WP_001312861.1 NZ_CP034592:48203-48361 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T116252 NZ_CP034592:48203-48361 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT116252 NZ_CP034592:c48154-48091 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|