Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1822475..1822659 | Replicon | chromosome |
Accession | NZ_CP034486 | ||
Organism | Staphylococcus aureus strain PMB 64-1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | EJN87_RS09535 | Protein ID | WP_000482647.1 |
Coordinates | 1822552..1822659 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1822475..1822535 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN87_RS09510 | 1817949..1818116 | - | 168 | WP_001790576.1 | hypothetical protein | - |
EJN87_RS09520 | 1818347..1820080 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
EJN87_RS09525 | 1820105..1821868 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
- | 1822475..1822535 | + | 61 | - | - | Antitoxin |
EJN87_RS09535 | 1822552..1822659 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EJN87_RS09540 | 1822793..1823179 | - | 387 | WP_000779360.1 | flippase GtxA | - |
EJN87_RS09545 | 1823437..1824579 | + | 1143 | WP_001176871.1 | glycerate kinase | - |
EJN87_RS09550 | 1824639..1825298 | + | 660 | WP_000831301.1 | membrane protein | - |
EJN87_RS09555 | 1825480..1826691 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
EJN87_RS09560 | 1826814..1827287 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T116189 WP_000482647.1 NZ_CP034486:c1822659-1822552 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T116189 NZ_CP034486:c1822659-1822552 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT116189 NZ_CP034486:1822475-1822535 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|