Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 1540048..1540245 | Replicon | chromosome |
Accession | NZ_CP034486 | ||
Organism | Staphylococcus aureus strain PMB 64-1 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | EJN87_RS08005 | Protein ID | WP_001802298.1 |
Coordinates | 1540141..1540245 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1540048..1540086 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN87_RS07985 | 1536232..1536897 | - | 666 | WP_001024105.1 | SDR family oxidoreductase | - |
EJN87_RS07990 | 1537049..1537369 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
EJN87_RS07995 | 1537371..1538351 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
EJN87_RS08000 | 1538617..1539708 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 1540048..1540086 | + | 39 | - | - | Antitoxin |
EJN87_RS08005 | 1540141..1540245 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
EJN87_RS08015 | 1540925..1541083 | + | 159 | WP_001792784.1 | hypothetical protein | - |
EJN87_RS08025 | 1541742..1542599 | - | 858 | WP_000370917.1 | Cof-type HAD-IIB family hydrolase | - |
EJN87_RS08030 | 1542667..1543449 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T116187 WP_001802298.1 NZ_CP034486:c1540245-1540141 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T116187 NZ_CP034486:c1540245-1540141 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT116187 NZ_CP034486:1540048-1540086 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|