Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1240864..1241046 | Replicon | chromosome |
| Accession | NZ_CP034486 | ||
| Organism | Staphylococcus aureus strain PMB 64-1 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EJN87_RS06230 | Protein ID | WP_001801861.1 |
| Coordinates | 1240864..1240959 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1240987..1241046 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJN87_RS06180 | 1236534..1237160 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| EJN87_RS06185 | 1237201..1237542 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| EJN87_RS06190 | 1237643..1238215 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| EJN87_RS06195 | 1238413..1238970 | - | 558 | Protein_1177 | ImmA/IrrE family metallo-endopeptidase | - |
| EJN87_RS06205 | 1239344..1239520 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| EJN87_RS06210 | 1239531..1239914 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| EJN87_RS06220 | 1240518..1240661 | - | 144 | WP_001549059.1 | transposase | - |
| EJN87_RS06230 | 1240864..1240959 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1240987..1241046 | - | 60 | - | - | Antitoxin |
| EJN87_RS06235 | 1241082..1241183 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| EJN87_RS06240 | 1241161..1241337 | - | 177 | Protein_1183 | transposase | - |
| EJN87_RS06245 | 1241531..1241908 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1217168..1306089 | 88921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T116182 WP_001801861.1 NZ_CP034486:1240864-1240959 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T116182 NZ_CP034486:1240864-1240959 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT116182 NZ_CP034486:c1241046-1240987 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|