Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2341079..2341261 | Replicon | chromosome |
| Accession | NZ_CP034441 | ||
| Organism | Staphylococcus aureus strain PMB 81-4 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EJN89_RS12315 | Protein ID | WP_001801861.1 |
| Coordinates | 2341166..2341261 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2341079..2341138 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJN89_RS12300 | 2340217..2340594 | + | 378 | Protein_2250 | DUF1433 domain-containing protein | - |
| EJN89_RS12305 | 2340788..2340964 | + | 177 | Protein_2251 | transposase | - |
| EJN89_RS12310 | 2340942..2341043 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 2341079..2341138 | + | 60 | - | - | Antitoxin |
| EJN89_RS12315 | 2341166..2341261 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| EJN89_RS12325 | 2341464..2341607 | + | 144 | WP_001549059.1 | transposase | - |
| EJN89_RS12335 | 2342211..2342594 | + | 384 | WP_000070814.1 | hypothetical protein | - |
| EJN89_RS12340 | 2342605..2342781 | + | 177 | WP_000375477.1 | hypothetical protein | - |
| EJN89_RS12350 | 2343155..2343712 | + | 558 | Protein_2257 | ImmA/IrrE family metallo-endopeptidase | - |
| EJN89_RS12355 | 2343910..2344482 | - | 573 | WP_000414202.1 | hypothetical protein | - |
| EJN89_RS12360 | 2344583..2344924 | - | 342 | WP_000627541.1 | DUF3969 family protein | - |
| EJN89_RS12365 | 2344965..2345591 | - | 627 | WP_000669017.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2322559..2348149 | 25590 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T116049 WP_001801861.1 NZ_CP034441:c2341261-2341166 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T116049 NZ_CP034441:c2341261-2341166 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT116049 NZ_CP034441:2341079-2341138 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|