Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1729126..1729310 | Replicon | chromosome |
Accession | NZ_CP034441 | ||
Organism | Staphylococcus aureus strain PMB 81-4 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | EJN89_RS08745 | Protein ID | WP_000482647.1 |
Coordinates | 1729126..1729233 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1729251..1729310 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN89_RS08720 | 1724498..1724971 | + | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
EJN89_RS08725 | 1725094..1726305 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
EJN89_RS08730 | 1726487..1727146 | - | 660 | WP_000831301.1 | membrane protein | - |
EJN89_RS08735 | 1727206..1728348 | - | 1143 | WP_001176871.1 | glycerate kinase | - |
EJN89_RS08740 | 1728606..1728992 | + | 387 | WP_000779360.1 | flippase GtxA | - |
EJN89_RS08745 | 1729126..1729233 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1729251..1729310 | - | 60 | - | - | Antitoxin |
EJN89_RS08755 | 1729917..1731680 | + | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
EJN89_RS08760 | 1731705..1733438 | + | 1734 | WP_125998338.1 | ABC transporter ATP-binding protein/permease | - |
EJN89_RS08770 | 1733669..1733836 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T116036 WP_000482647.1 NZ_CP034441:1729126-1729233 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T116036 NZ_CP034441:1729126-1729233 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 60 bp
>AT116036 NZ_CP034441:c1729310-1729251 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGG
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|