Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 37143..37413 | Replicon | plasmid pKPC-CR-hvKP-C789 |
Accession | NZ_CP034417 | ||
Organism | Klebsiella pneumoniae strain C789 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | EJJ25_RS28000 | Protein ID | WP_001312861.1 |
Coordinates | 37255..37413 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 37143..37206 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJJ25_RS27975 | 32854..33381 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
EJJ25_RS27980 | 33439..33672 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
EJJ25_RS27985 | 33733..35756 | + | 2024 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
EJJ25_RS27990 | 35825..36259 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
EJJ25_RS27995 | 36256..36975 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 37143..37206 | - | 64 | - | - | Antitoxin |
EJJ25_RS28000 | 37255..37413 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
EJJ25_RS30310 | 37651..38028 | - | 378 | Protein_49 | hypothetical protein | - |
EJJ25_RS28010 | 38328..38624 | + | 297 | WP_001272251.1 | hypothetical protein | - |
EJJ25_RS28015 | 38735..39556 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
EJJ25_RS28020 | 39853..40500 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
EJJ25_RS28025 | 40777..41160 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
EJJ25_RS28030 | 41351..42037 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
EJJ25_RS28035 | 42131..42358 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..128299 | 128299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T115996 WP_001312861.1 NZ_CP034417:37255-37413 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T115996 NZ_CP034417:37255-37413 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT115996 NZ_CP034417:c37206-37143 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|