Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 15486..15726 | Replicon | plasmid pCRE10.1 |
Accession | NZ_CP034401 | ||
Organism | Escherichia coli strain CRE10 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | EJC75_RS00120 | Protein ID | WP_001312861.1 |
Coordinates | 15486..15644 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 15688..15726 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJC75_RS00085 | 11061..11663 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
EJC75_RS00090 | 11960..12781 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
EJC75_RS00095 | 12900..13187 | - | 288 | WP_000107535.1 | hypothetical protein | - |
EJC75_RS00100 | 13438..14418 | + | 981 | WP_032154316.1 | IS110 family transposase | - |
EJC75_RS26355 | 14604..14795 | - | 192 | Protein_20 | single-stranded DNA-binding protein | - |
EJC75_RS00120 | 15486..15644 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 15688..15726 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 15688..15726 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 15688..15726 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 15688..15726 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 17166..17268 | - | 103 | NuclAT_0 | - | - |
- | 17166..17268 | - | 103 | NuclAT_0 | - | - |
- | 17166..17268 | - | 103 | NuclAT_0 | - | - |
- | 17166..17268 | - | 103 | NuclAT_0 | - | - |
EJC75_RS00130 | 17280..17999 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
EJC75_RS00135 | 17996..18430 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
EJC75_RS00140 | 18485..20443 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / catB3 / blaOXA-1 / aac(6')-Ib-cr / dfrA17 / aadA5 / qacE / mph(A) / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId | - | 1..134611 | 134611 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T115907 WP_001312861.1 NZ_CP034401:c15644-15486 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T115907 NZ_CP034401:c15644-15486 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 39 bp
>AT115907 NZ_CP034401:c15726-15688 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|