Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2388638..2388822 | Replicon | chromosome |
Accession | NZ_CP034349 | ||
Organism | Staphylococcus aureus strain 80wphwpl |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | C6567_RS12120 | Protein ID | WP_000482648.1 |
Coordinates | 2388715..2388822 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2388638..2388698 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6567_RS12095 | 2384148..2384315 | - | 168 | Protein_2245 | hypothetical protein | - |
C6567_RS12105 | 2384546..2386279 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
C6567_RS12110 | 2386304..2388067 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2388638..2388698 | + | 61 | - | - | Antitoxin |
C6567_RS12120 | 2388715..2388822 | - | 108 | WP_000482648.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
C6567_RS12125 | 2388956..2389342 | - | 387 | WP_000779351.1 | flippase GtxA | - |
C6567_RS12130 | 2389610..2390752 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
C6567_RS12135 | 2390812..2391471 | + | 660 | WP_000831298.1 | membrane protein | - |
C6567_RS12140 | 2391653..2392864 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
C6567_RS12145 | 2392987..2393460 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4026.79 Da Isoelectric Point: 10.4935
>T115768 WP_000482648.1 NZ_CP034349:c2388822-2388715 [Staphylococcus aureus]
MFNLLIEIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIEIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T115768 NZ_CP034349:c2388822-2388715 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGAAATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGAAATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT115768 NZ_CP034349:2388638-2388698 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|