Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2103622..2103819 | Replicon | chromosome |
Accession | NZ_CP034349 | ||
Organism | Staphylococcus aureus strain 80wphwpl |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | C6567_RS10565 | Protein ID | WP_073392962.1 |
Coordinates | 2103715..2103819 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2103622..2103660 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6567_RS10545 | 2099797..2100462 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
C6567_RS10550 | 2100614..2100934 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
C6567_RS10555 | 2100936..2101916 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
C6567_RS10560 | 2102182..2103273 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
- | 2103622..2103660 | + | 39 | - | - | Antitoxin |
C6567_RS10565 | 2103715..2103819 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
C6567_RS10575 | 2104499..2104657 | + | 159 | WP_001792784.1 | hypothetical protein | - |
C6567_RS10585 | 2105316..2106173 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
C6567_RS10590 | 2106241..2107023 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T115766 WP_073392962.1 NZ_CP034349:c2103819-2103715 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T115766 NZ_CP034349:c2103819-2103715 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT115766 NZ_CP034349:2103622-2103660 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|