Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1812882..1813062 | Replicon | chromosome |
Accession | NZ_CP034349 | ||
Organism | Staphylococcus aureus strain 80wphwpl |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | C6567_RS08870 | Protein ID | WP_001801861.1 |
Coordinates | 1812882..1812977 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1813005..1813062 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6567_RS08835 | 1808026..1808652 | + | 627 | WP_000669038.1 | hypothetical protein | - |
C6567_RS08840 | 1808693..1809037 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
C6567_RS08845 | 1809135..1809707 | + | 573 | WP_000414222.1 | hypothetical protein | - |
C6567_RS08850 | 1809856..1811223 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
C6567_RS08855 | 1811223..1811792 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
C6567_RS08860 | 1811985..1812431 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
C6567_RS08870 | 1812882..1812977 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1813005..1813062 | - | 58 | - | - | Antitoxin |
C6567_RS08875 | 1813100..1813201 | + | 102 | WP_001791232.1 | hypothetical protein | - |
C6567_RS08880 | 1813376..1813819 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
C6567_RS08885 | 1813819..1814262 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
C6567_RS08890 | 1814262..1814704 | - | 443 | Protein_1682 | DUF1433 domain-containing protein | - |
C6567_RS08895 | 1815229..1817649 | + | 2421 | WP_000182551.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T115760 WP_001801861.1 NZ_CP034349:1812882-1812977 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T115760 NZ_CP034349:1812882-1812977 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT115760 NZ_CP034349:c1813062-1813005 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|