Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2504339..2504523 | Replicon | chromosome |
Accession | NZ_CP034259 | ||
Organism | Staphylococcus aureus strain P1D12C1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | EFD74_RS12535 | Protein ID | WP_000482652.1 |
Coordinates | 2504416..2504523 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2504339..2504399 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EFD74_RS12520 | 2499794..2499961 | - | 168 | Protein_2401 | hypothetical protein | - |
EFD74_RS12525 | 2500192..2501925 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
EFD74_RS12530 | 2501950..2503713 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2504339..2504399 | + | 61 | - | - | Antitoxin |
EFD74_RS12535 | 2504416..2504523 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EFD74_RS12540 | 2504657..2505043 | - | 387 | WP_000779360.1 | flippase GtxA | - |
EFD74_RS12545 | 2505311..2506453 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
EFD74_RS12550 | 2506513..2507172 | + | 660 | WP_000831298.1 | membrane protein | - |
EFD74_RS12555 | 2507354..2508565 | + | 1212 | WP_156668050.1 | multidrug effflux MFS transporter | - |
EFD74_RS12560 | 2508688..2509161 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T115634 WP_000482652.1 NZ_CP034259:c2504523-2504416 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T115634 NZ_CP034259:c2504523-2504416 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT115634 NZ_CP034259:2504339-2504399 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|