Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4410466..4410664 | Replicon | chromosome |
Accession | NZ_CP034213 | ||
Organism | Escherichia albertii strain NCTC 9362 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | DSB70_RS22665 | Protein ID | WP_000813244.1 |
Coordinates | 4410509..4410664 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4410466..4410497 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DSB70_RS22630 | 4405813..4406199 | + | 387 | WP_000470023.1 | hypothetical protein | - |
DSB70_RS22635 | 4406193..4407713 | + | 1521 | WP_032274375.1 | DEAD/DEAH box helicase | - |
DSB70_RS22640 | 4407703..4408674 | + | 972 | WP_032274376.1 | primase-helicase zinc-binding domain-containing protein | - |
DSB70_RS22645 | 4408674..4409123 | + | 450 | WP_000402092.1 | DUF1367 family protein | - |
DSB70_RS22650 | 4409131..4409694 | + | 564 | WP_032274377.1 | recombination protein NinG | - |
DSB70_RS22655 | 4409691..4409891 | + | 201 | WP_000144761.1 | phage NinH family protein | - |
DSB70_RS22660 | 4409884..4410309 | + | 426 | WP_001204831.1 | antiterminator Q family protein | - |
- | 4410466..4410497 | - | 32 | - | - | Antitoxin |
DSB70_RS22665 | 4410509..4410664 | + | 156 | WP_000813244.1 | Hok/Gef family protein | Toxin |
DSB70_RS22670 | 4410821..4411186 | - | 366 | WP_241201485.1 | hypothetical protein | - |
DSB70_RS22675 | 4411267..4413228 | + | 1962 | WP_001178557.1 | N-6 DNA methylase | - |
DSB70_RS22680 | 4413297..4414382 | + | 1086 | WP_001340208.1 | restriction endonuclease subunit S | - |
DSB70_RS22685 | 4414645..4414797 | + | 153 | WP_001304085.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4383586..4450764 | 67178 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5799.99 Da Isoelectric Point: 7.7942
>T115533 WP_000813244.1 NZ_CP034213:4410509-4410664 [Escherichia albertii]
MKQQKAMLIALIVICITVVVIALVTRKDFCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICITVVVIALVTRKDFCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T115533 NZ_CP034213:4410509-4410664 [Escherichia albertii]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTATTACCGTCGTAGTGATAGCACTGGTAACGAGGAA
AGACTTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTATTACCGTCGTAGTGATAGCACTGGTAACGAGGAA
AGACTTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 32 bp
>AT115533 NZ_CP034213:c4410497-4410466 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|