Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3214043..3214300 | Replicon | chromosome |
| Accession | NZ_CP034213 | ||
| Organism | Escherichia albertii strain NCTC 9362 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | - |
| Locus tag | DSB70_RS16325 | Protein ID | WP_032275378.1 |
| Coordinates | 3214148..3214300 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 3214043..3214091 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DSB70_RS16300 | 3209665..3209964 | + | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
| DSB70_RS16305 | 3210060..3210971 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| DSB70_RS16310 | 3210981..3213050 | + | 2070 | WP_125060281.1 | glycine--tRNA ligase subunit beta | - |
| DSB70_RS16315 | 3213012..3213272 | - | 261 | WP_125060282.1 | hypothetical protein | - |
| DSB70_RS16320 | 3213171..3213868 | + | 698 | WP_094106546.1 | IS1 family transposase | - |
| - | 3214043..3214091 | - | 49 | - | - | Antitoxin |
| DSB70_RS16325 | 3214148..3214300 | + | 153 | WP_032275378.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| DSB70_RS16330 | 3214452..3215138 | + | 687 | WP_125060283.1 | hypothetical protein | - |
| DSB70_RS16335 | 3215206..3215418 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| DSB70_RS16340 | 3215701..3215991 | - | 291 | WP_125060284.1 | HTH-type transcriptional regulator | - |
| DSB70_RS16345 | 3216414..3217124 | + | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| DSB70_RS16350 | 3217177..3218151 | - | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| DSB70_RS16355 | 3218255..3218914 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3213365..3213868 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5762.95 Da Isoelectric Point: 8.2833
>T115528 WP_032275378.1 NZ_CP034213:3214148-3214300 [Escherichia albertii]
MPQRYLLFGLVVICFTLLLFTWMVRDSLCELHIKQGSNELATFLACGNKK
MPQRYLLFGLVVICFTLLLFTWMVRDSLCELHIKQGSNELATFLACGNKK
Download Length: 153 bp
>T115528 NZ_CP034213:3214148-3214300 [Escherichia albertii]
ATGCCGCAGAGATATTTGTTATTTGGCTTAGTAGTGATTTGTTTCACGCTATTATTATTTACCTGGATGGTAAGAGATTC
ACTGTGTGAATTACATATTAAGCAGGGAAGTAATGAGCTGGCGACATTTTTAGCCTGTGGAAATAAAAAGTAA
ATGCCGCAGAGATATTTGTTATTTGGCTTAGTAGTGATTTGTTTCACGCTATTATTATTTACCTGGATGGTAAGAGATTC
ACTGTGTGAATTACATATTAAGCAGGGAAGTAATGAGCTGGCGACATTTTTAGCCTGTGGAAATAAAAAGTAA
Antitoxin
Download Length: 49 bp
>AT115528 NZ_CP034213:c3214091-3214043 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|