Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4565701..4565926 | Replicon | chromosome |
Accession | NZ_CP034166 | ||
Organism | Escherichia albertii strain 2014C-4015 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A7L6L988 |
Locus tag | AYR02_RS23535 | Protein ID | WP_000813269.1 |
Coordinates | 4565771..4565926 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4565701..4565759 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AYR02_RS23495 | 4560916..4561143 | + | 228 | WP_059278068.1 | cell division protein | - |
AYR02_RS23500 | 4561140..4561565 | + | 426 | WP_124783262.1 | Rha family transcriptional regulator | - |
AYR02_RS23505 | 4561589..4562551 | + | 963 | WP_072248488.1 | helix-turn-helix domain-containing protein | - |
AYR02_RS23510 | 4562558..4563111 | + | 554 | Protein_4294 | ATP-binding protein | - |
AYR02_RS23515 | 4563134..4563895 | + | 762 | WP_124783263.1 | DUF1627 domain-containing protein | - |
AYR02_RS23520 | 4563903..4564319 | + | 417 | WP_124783264.1 | DUF977 family protein | - |
AYR02_RS23525 | 4564478..4564887 | + | 410 | Protein_4297 | hypothetical protein | - |
AYR02_RS24880 | 4565034..4565231 | + | 198 | Protein_4298 | DUF551 domain-containing protein | - |
- | 4565701..4565759 | - | 59 | - | - | Antitoxin |
AYR02_RS23535 | 4565771..4565926 | + | 156 | WP_000813269.1 | type I toxin-antitoxin system toxin HokD | Toxin |
AYR02_RS23540 | 4566094..4566372 | + | 279 | WP_072256172.1 | hypothetical protein | - |
AYR02_RS23545 | 4566374..4567410 | + | 1037 | Protein_4301 | DUF968 domain-containing protein | - |
AYR02_RS23550 | 4567411..4567791 | + | 381 | WP_124783265.1 | RusA family crossover junction endodeoxyribonuclease | - |
AYR02_RS23555 | 4567788..4568609 | + | 822 | WP_059278988.1 | antitermination protein | - |
AYR02_RS23570 | 4569350..4569565 | + | 216 | WP_000839572.1 | class II holin family protein | - |
AYR02_RS23575 | 4569569..4570222 | + | 654 | Protein_4305 | hypothetical protein | - |
AYR02_RS23580 | 4570267..4570494 | + | 228 | WP_059278985.1 | DUF1327 domain-containing protein | - |
AYR02_RS23585 | 4570499..4570786 | - | 288 | WP_059278986.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4548459..4592291 | 43832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T115442 WP_000813269.1 NZ_CP034166:4565771-4565926 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T115442 NZ_CP034166:4565771-4565926 [Escherichia albertii]
ATGAAGCAGCAAAAGGCGATGTTAGTCGCCCTGATCGTCATCTGTTTAACCGTCATTGTTACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAGTCGCCCTGATCGTCATCTGTTTAACCGTCATTGTTACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT115442 NZ_CP034166:c4565759-4565701 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|