Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2311103..2311360 | Replicon | chromosome |
| Accession | NZ_CP034166 | ||
| Organism | Escherichia albertii strain 2014C-4015 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | AYR02_RS12460 | Protein ID | WP_001135738.1 |
| Coordinates | 2311103..2311255 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 2311312..2311360 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYR02_RS12435 | 2307207..2307866 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
| AYR02_RS12440 | 2307970..2308944 | + | 975 | WP_059221283.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| AYR02_RS12445 | 2308997..2309707 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| AYR02_RS12450 | 2310130..2310420 | + | 291 | WP_059221281.1 | HTH-type transcriptional regulator | - |
| AYR02_RS12455 | 2310703..2310915 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| AYR02_RS12460 | 2311103..2311255 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 2311312..2311360 | + | 49 | - | - | Antitoxin |
| AYR02_RS12465 | 2311577..2313646 | - | 2070 | WP_124782659.1 | glycine--tRNA ligase subunit beta | - |
| AYR02_RS12470 | 2313656..2314567 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| AYR02_RS12475 | 2314663..2314962 | - | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
| AYR02_RS12480 | 2315135..2316130 | + | 996 | WP_059221277.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T115432 WP_001135738.1 NZ_CP034166:c2311255-2311103 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T115432 NZ_CP034166:c2311255-2311103 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGGGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGGGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
Antitoxin
Download Length: 49 bp
>AT115432 NZ_CP034166:2311312-2311360 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTAATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTAATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|