Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 576055..576280 | Replicon | chromosome |
| Accession | NZ_CP034166 | ||
| Organism | Escherichia albertii strain 2014C-4015 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A8H9SPE4 |
| Locus tag | AYR02_RS03880 | Protein ID | WP_001406737.1 |
| Coordinates | 576055..576210 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 576222..576280 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYR02_RS03825 | 571298..571513 | - | 216 | WP_000839596.1 | phage lysis protein EssD | - |
| AYR02_RS03830 | 572228..572791 | + | 564 | WP_024246368.1 | DUF1440 domain-containing protein | - |
| AYR02_RS03860 | 573475..574164 | - | 690 | WP_059269179.1 | antiterminator | - |
| AYR02_RS03865 | 574161..574526 | - | 366 | WP_059278097.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYR02_RS03870 | 574527..575579 | - | 1053 | Protein_555 | DUF968 domain-containing protein | - |
| AYR02_RS03875 | 575581..575859 | - | 279 | WP_032154696.1 | hypothetical protein | - |
| AYR02_RS03880 | 576055..576210 | - | 156 | WP_001406737.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 576222..576280 | + | 59 | - | - | Antitoxin |
| AYR02_RS24810 | 576761..576958 | - | 198 | Protein_558 | DUF551 domain-containing protein | - |
| AYR02_RS03895 | 577105..577428 | - | 324 | Protein_559 | hypothetical protein | - |
| AYR02_RS03900 | 577660..578856 | + | 1197 | WP_124781948.1 | IS110 family transposase | - |
| AYR02_RS03915 | 579142..579939 | + | 798 | WP_024164886.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | espJ / espFu/tccP / nleC | 542045..587484 | 45439 | |
| - | flank | IS/Tn | - | - | 577660..578856 | 1196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5794.93 Da Isoelectric Point: 4.8535
>T115424 WP_001406737.1 NZ_CP034166:c576210-576055 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
Download Length: 156 bp
>T115424 NZ_CP034166:c576210-576055 [Escherichia albertii]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGACCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGACCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT115424 NZ_CP034166:576222-576280 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAATCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAATCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|