Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 30205..30474 | Replicon | plasmid p2b2 |
Accession | NZ_CP034125 | ||
Organism | Klebsiella pneumoniae strain BJCFK909 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | EH202_RS31465 | Protein ID | WP_001312861.1 |
Coordinates | 30316..30474 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 30205..30270 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EH202_RS29040 | 25915..26442 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
EH202_RS29045 | 26500..26733 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
EH202_RS29050 | 26794..28817 | + | 2024 | Protein_36 | ParB/RepB/Spo0J family partition protein | - |
EH202_RS29055 | 28886..29320 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
EH202_RS29060 | 29317..30036 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30205..30270 | + | 66 | - | - | Antitoxin |
EH202_RS31465 | 30316..30474 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
EH202_RS31810 | 30712..31089 | - | 378 | Protein_40 | hypothetical protein | - |
EH202_RS29085 | 31389..31685 | + | 297 | WP_001272251.1 | hypothetical protein | - |
EH202_RS29090 | 31796..32617 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
EH202_RS29095 | 32914..33561 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
EH202_RS29100 | 33838..34221 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
EH202_RS29110 | 34502..35206 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..109179 | 109179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T115323 WP_001312861.1 NZ_CP034125:30316-30474 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T115323 NZ_CP034125:30316-30474 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT115323 NZ_CP034125:30205-30270 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|