Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 30204..30474 | Replicon | plasmid p2b2 |
| Accession | NZ_CP034125 | ||
| Organism | Klebsiella pneumoniae strain BJCFK909 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | EH202_RS31465 | Protein ID | WP_001312861.1 |
| Coordinates | 30316..30474 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 30204..30267 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EH202_RS29040 | 25915..26442 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| EH202_RS29045 | 26500..26733 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| EH202_RS29050 | 26794..28817 | + | 2024 | Protein_36 | ParB/RepB/Spo0J family partition protein | - |
| EH202_RS29055 | 28886..29320 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| EH202_RS29060 | 29317..30036 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 30048..30272 | + | 225 | NuclAT_0 | - | - |
| - | 30048..30272 | + | 225 | NuclAT_0 | - | - |
| - | 30048..30272 | + | 225 | NuclAT_0 | - | - |
| - | 30048..30272 | + | 225 | NuclAT_0 | - | - |
| - | 30204..30267 | - | 64 | - | - | Antitoxin |
| EH202_RS31465 | 30316..30474 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| EH202_RS31810 | 30712..31089 | - | 378 | Protein_40 | hypothetical protein | - |
| EH202_RS29085 | 31389..31685 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| EH202_RS29090 | 31796..32617 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| EH202_RS29095 | 32914..33561 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| EH202_RS29100 | 33838..34221 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| EH202_RS29110 | 34502..35206 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..109179 | 109179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T115322 WP_001312861.1 NZ_CP034125:30316-30474 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T115322 NZ_CP034125:30316-30474 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT115322 NZ_CP034125:c30267-30204 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|