Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1903803..1903983 | Replicon | chromosome |
Accession | NZ_CP034102 | ||
Organism | Staphylococcus aureus strain O267 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SaO267_RS09685 | Protein ID | WP_001801861.1 |
Coordinates | 1903803..1903898 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1903926..1903983 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO267_RS09650 | 1899207..1899833 | + | 627 | WP_000669034.1 | hypothetical protein | - |
SaO267_RS09655 | 1899874..1900215 | + | 342 | WP_000627544.1 | DUF3969 family protein | - |
SaO267_RS09660 | 1900316..1900888 | + | 573 | WP_000414210.1 | hypothetical protein | - |
SaO267_RS09665 | 1901264..1902100 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
SaO267_RS09675 | 1902906..1903352 | - | 447 | WP_000747806.1 | DUF1433 domain-containing protein | - |
SaO267_RS09685 | 1903803..1903898 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1903926..1903983 | - | 58 | - | - | Antitoxin |
SaO267_RS09690 | 1904021..1904122 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SaO267_RS09695 | 1904108..1904287 | - | 180 | Protein_1831 | transposase | - |
SaO267_RS09700 | 1904475..1904849 | - | 375 | WP_000695817.1 | DUF1433 domain-containing protein | - |
SaO267_RS09705 | 1904839..1905219 | - | 381 | WP_001035978.1 | DUF1433 domain-containing protein | - |
SaO267_RS09710 | 1905427..1905867 | - | 441 | WP_000759945.1 | DUF1433 domain-containing protein | - |
SaO267_RS09715 | 1905912..1907525 | + | 1614 | WP_000926709.1 | hypothetical protein | - |
SaO267_RS09720 | 1907540..1907839 | + | 300 | WP_000095391.1 | WXG100 family type VII secretion target | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T115225 WP_001801861.1 NZ_CP034102:1903803-1903898 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T115225 NZ_CP034102:1903803-1903898 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT115225 NZ_CP034102:c1903983-1903926 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|