Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4334073..4334294 Replicon chromosome
Accession NZ_CP033884
Organism Escherichia coli strain 50579417

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag EGM66_RS23430 Protein ID WP_000176713.1
Coordinates 4334073..4334180 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4334228..4334294 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EGM66_RS23395 4329207..4330289 + 1083 WP_000804726.1 peptide chain release factor 1 -
EGM66_RS23400 4330289..4331122 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
EGM66_RS23405 4331119..4331511 + 393 WP_000200377.1 invasion regulator SirB2 -
EGM66_RS23410 4331515..4332324 + 810 WP_001257044.1 invasion regulator SirB1 -
EGM66_RS23415 4332360..4333214 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
EGM66_RS23425 4333409..4333867 + 459 WP_000526135.1 IS200/IS605 family transposase -
EGM66_RS23430 4334073..4334180 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4334228..4334294 + 67 NuclAT_21 - Antitoxin
- 4334228..4334294 + 67 NuclAT_21 - Antitoxin
- 4334228..4334294 + 67 NuclAT_21 - Antitoxin
- 4334228..4334294 + 67 NuclAT_21 - Antitoxin
- 4334228..4334294 + 67 NuclAT_26 - Antitoxin
- 4334228..4334294 + 67 NuclAT_26 - Antitoxin
- 4334228..4334294 + 67 NuclAT_26 - Antitoxin
- 4334228..4334294 + 67 NuclAT_26 - Antitoxin
- 4334228..4334294 + 67 NuclAT_31 - Antitoxin
- 4334228..4334294 + 67 NuclAT_31 - Antitoxin
- 4334228..4334294 + 67 NuclAT_31 - Antitoxin
- 4334228..4334294 + 67 NuclAT_31 - Antitoxin
- 4334228..4334294 + 67 NuclAT_36 - Antitoxin
- 4334228..4334294 + 67 NuclAT_36 - Antitoxin
- 4334228..4334294 + 67 NuclAT_36 - Antitoxin
- 4334228..4334294 + 67 NuclAT_36 - Antitoxin
- 4334228..4334294 + 67 NuclAT_38 - Antitoxin
- 4334228..4334294 + 67 NuclAT_38 - Antitoxin
- 4334228..4334294 + 67 NuclAT_38 - Antitoxin
- 4334228..4334294 + 67 NuclAT_38 - Antitoxin
- 4334228..4334294 + 67 NuclAT_43 - Antitoxin
- 4334228..4334294 + 67 NuclAT_43 - Antitoxin
- 4334228..4334294 + 67 NuclAT_43 - Antitoxin
- 4334228..4334294 + 67 NuclAT_43 - Antitoxin
- 4334230..4334293 + 64 NuclAT_46 - -
- 4334230..4334293 + 64 NuclAT_46 - -
- 4334230..4334293 + 64 NuclAT_46 - -
- 4334230..4334293 + 64 NuclAT_46 - -
- 4334230..4334293 + 64 NuclAT_48 - -
- 4334230..4334293 + 64 NuclAT_48 - -
- 4334230..4334293 + 64 NuclAT_48 - -
- 4334230..4334293 + 64 NuclAT_48 - -
EGM66_RS23435 4334608..4334715 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 4334768..4334829 + 62 NuclAT_45 - -
- 4334768..4334829 + 62 NuclAT_45 - -
- 4334768..4334829 + 62 NuclAT_45 - -
- 4334768..4334829 + 62 NuclAT_45 - -
- 4334768..4334829 + 62 NuclAT_47 - -
- 4334768..4334829 + 62 NuclAT_47 - -
- 4334768..4334829 + 62 NuclAT_47 - -
- 4334768..4334829 + 62 NuclAT_47 - -
- 4334768..4334830 + 63 NuclAT_22 - -
- 4334768..4334830 + 63 NuclAT_22 - -
- 4334768..4334830 + 63 NuclAT_22 - -
- 4334768..4334830 + 63 NuclAT_22 - -
- 4334768..4334830 + 63 NuclAT_27 - -
- 4334768..4334830 + 63 NuclAT_27 - -
- 4334768..4334830 + 63 NuclAT_27 - -
- 4334768..4334830 + 63 NuclAT_27 - -
- 4334768..4334830 + 63 NuclAT_32 - -
- 4334768..4334830 + 63 NuclAT_32 - -
- 4334768..4334830 + 63 NuclAT_32 - -
- 4334768..4334830 + 63 NuclAT_32 - -
- 4334768..4334830 + 63 NuclAT_37 - -
- 4334768..4334830 + 63 NuclAT_37 - -
- 4334768..4334830 + 63 NuclAT_37 - -
- 4334768..4334830 + 63 NuclAT_37 - -
- 4334768..4334830 + 63 NuclAT_39 - -
- 4334768..4334830 + 63 NuclAT_39 - -
- 4334768..4334830 + 63 NuclAT_39 - -
- 4334768..4334830 + 63 NuclAT_39 - -
- 4334768..4334830 + 63 NuclAT_44 - -
- 4334768..4334830 + 63 NuclAT_44 - -
- 4334768..4334830 + 63 NuclAT_44 - -
- 4334768..4334830 + 63 NuclAT_44 - -
EGM66_RS23440 4335121..4336221 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
EGM66_RS23445 4336491..4336721 + 231 WP_001146444.1 putative cation transport regulator ChaB -
EGM66_RS23450 4336879..4337574 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
EGM66_RS23455 4337618..4337971 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4333409..4333867 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T114590 WP_000176713.1 NZ_CP033884:c4334180-4334073 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T114590 NZ_CP033884:c4334180-4334073 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT114590 NZ_CP033884:4334228-4334294 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References