Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2041456..2041640 | Replicon | chromosome |
Accession | NZ_CP033865 | ||
Organism | Staphylococcus aureus strain FDAARGOS_504 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | EG363_RS10880 | Protein ID | WP_000482647.1 |
Coordinates | 2041533..2041640 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2041456..2041516 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EG363_RS10855 | 2036966..2037133 | - | 168 | Protein_2026 | hypothetical protein | - |
EG363_RS10865 | 2037364..2039097 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
EG363_RS10870 | 2039122..2040885 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2041456..2041516 | + | 61 | - | - | Antitoxin |
EG363_RS10880 | 2041533..2041640 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EG363_RS10885 | 2041774..2042160 | - | 387 | WP_000779351.1 | flippase GtxA | - |
EG363_RS10890 | 2042428..2043570 | + | 1143 | WP_001176857.1 | glycerate kinase | - |
EG363_RS10895 | 2043630..2044289 | + | 660 | WP_000831298.1 | membrane protein | - |
EG363_RS10900 | 2044471..2045682 | + | 1212 | WP_001191920.1 | multidrug effflux MFS transporter | - |
EG363_RS10905 | 2045805..2046278 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T114545 WP_000482647.1 NZ_CP033865:c2041640-2041533 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T114545 NZ_CP033865:c2041640-2041533 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT114545 NZ_CP033865:2041456-2041516 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|