Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1381986..1382166 | Replicon | chromosome |
Accession | NZ_CP033865 | ||
Organism | Staphylococcus aureus strain FDAARGOS_504 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EG363_RS06960 | Protein ID | WP_001801861.1 |
Coordinates | 1381986..1382081 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1382109..1382166 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EG363_RS06925 | 1377130..1377756 | + | 627 | WP_000669038.1 | hypothetical protein | - |
EG363_RS06930 | 1377797..1378141 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
EG363_RS06935 | 1378239..1378811 | + | 573 | WP_000414222.1 | hypothetical protein | - |
EG363_RS06940 | 1378960..1380327 | - | 1368 | WP_078263561.1 | FRG domain-containing protein | - |
EG363_RS06945 | 1380327..1380896 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
EG363_RS06950 | 1381089..1381535 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
EG363_RS06960 | 1381986..1382081 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1382109..1382166 | - | 58 | - | - | Antitoxin |
EG363_RS06965 | 1382204..1382305 | + | 102 | WP_001791232.1 | hypothetical protein | - |
EG363_RS06970 | 1382480..1382923 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
EG363_RS06975 | 1382923..1383366 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
EG363_RS06980 | 1383366..1383808 | - | 443 | Protein_1330 | DUF1433 domain-containing protein | - |
EG363_RS06985 | 1384332..1386752 | + | 2421 | WP_064135637.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T114532 WP_001801861.1 NZ_CP033865:1381986-1382081 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T114532 NZ_CP033865:1381986-1382081 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT114532 NZ_CP033865:c1382166-1382109 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|