Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3717878..3718099 | Replicon | chromosome |
Accession | NZ_CP033850 | ||
Organism | Escherichia coli strain FDAARGOS_497 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A1D7PZ30 |
Locus tag | EGY17_RS19915 | Protein ID | WP_022645587.1 |
Coordinates | 3717878..3717985 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3718033..3718099 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EGY17_RS19890 | 3713722..3714804 | + | 1083 | WP_022645584.1 | peptide chain release factor 1 | - |
EGY17_RS19895 | 3714804..3715637 | + | 834 | WP_022645585.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
EGY17_RS19900 | 3715634..3716026 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
EGY17_RS19905 | 3716030..3716839 | + | 810 | WP_022645586.1 | invasion regulator SirB1 | - |
EGY17_RS19910 | 3716875..3717729 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
EGY17_RS19915 | 3717878..3717985 | - | 108 | WP_022645587.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 3718033..3718099 | + | 67 | NuclAT_31 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_31 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_31 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_31 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_33 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_33 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_33 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_33 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_35 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_35 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_35 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_35 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_37 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_37 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_37 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_37 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_39 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 3718033..3718099 | + | 67 | NuclAT_41 | - | Antitoxin |
- | 3718035..3718092 | + | 58 | NuclAT_44 | - | - |
- | 3718035..3718092 | + | 58 | NuclAT_44 | - | - |
- | 3718035..3718092 | + | 58 | NuclAT_44 | - | - |
- | 3718035..3718092 | + | 58 | NuclAT_44 | - | - |
EGY17_RS19920 | 3718413..3718520 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 3718573..3718634 | + | 62 | NuclAT_43 | - | - |
- | 3718573..3718634 | + | 62 | NuclAT_43 | - | - |
- | 3718573..3718634 | + | 62 | NuclAT_43 | - | - |
- | 3718573..3718634 | + | 62 | NuclAT_43 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_32 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_32 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_32 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_32 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_34 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_34 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_34 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_34 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_36 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_36 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_36 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_36 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_38 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_38 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_38 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_38 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_40 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_40 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_40 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_40 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_42 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_42 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_42 | - | - |
- | 3718573..3718635 | + | 63 | NuclAT_42 | - | - |
EGY17_RS19925 | 3718926..3720026 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
EGY17_RS19930 | 3720296..3720526 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
EGY17_RS19935 | 3720684..3721379 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
EGY17_RS19940 | 3721423..3721776 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4029.82 Da Isoelectric Point: 11.4779
>T114508 WP_022645587.1 NZ_CP033850:c3717985-3717878 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T114508 NZ_CP033850:c3717985-3717878 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT114508 NZ_CP033850:3718033-3718099 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGGTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGGTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|