Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 1080600..1080936 | Replicon | chromosome |
Accession | NZ_CP033787 | ||
Organism | Enterococcus faecalis strain FDAARGOS_528 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | EGX75_RS05495 | Protein ID | WP_002396786.1 |
Coordinates | 1080793..1080936 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 1080600..1080649 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EGX75_RS05490 | 1075928..1080598 | + | 4671 | WP_123839673.1 | WxL domain-containing protein | - |
- | 1080600..1080649 | - | 50 | - | - | Antitoxin |
EGX75_RS05495 | 1080793..1080936 | - | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
EGX75_RS05500 | 1081167..1081307 | - | 141 | WP_077143780.1 | putative holin-like toxin | - |
EGX75_RS05505 | 1081426..1081623 | - | 198 | WP_002358966.1 | putative holin-like toxin | - |
EGX75_RS05510 | 1081809..1081931 | - | 123 | WP_002404776.1 | putative holin-like toxin | - |
EGX75_RS05515 | 1082286..1083902 | - | 1617 | WP_123839674.1 | phosphatase PAP2/LCP family protein | - |
EGX75_RS05530 | 1084364..1085659 | + | 1296 | WP_002396787.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T114343 WP_002396786.1 NZ_CP033787:c1080936-1080793 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
>T114343 NZ_CP033787:c1080936-1080793 [Enterococcus faecalis]
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
Antitoxin
Download Length: 50 bp
>AT114343 NZ_CP033787:c1080649-1080600 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|