Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 660253..660447 | Replicon | chromosome |
Accession | NZ_CP033787 | ||
Organism | Enterococcus faecalis strain FDAARGOS_528 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | EGX75_RS15175 | Protein ID | WP_015543884.1 |
Coordinates | 660253..660348 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 660383..660447 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EGX75_RS03325 | 655431..656546 | + | 1116 | WP_002358395.1 | FAD-binding oxidoreductase | - |
EGX75_RS03330 | 656614..657768 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
EGX75_RS03335 | 657783..658220 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
EGX75_RS03340 | 658235..660007 | - | 1773 | WP_123839659.1 | PTS mannitol transporter subunit IICBA | - |
EGX75_RS15175 | 660253..660348 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 660383..660447 | - | 65 | - | - | Antitoxin |
EGX75_RS03350 | 660618..661052 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
EGX75_RS03355 | 661063..663096 | - | 2034 | WP_002358390.1 | transcription antiterminator | - |
EGX75_RS03360 | 663087..664835 | - | 1749 | WP_010708249.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T114340 WP_015543884.1 NZ_CP033787:660253-660348 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T114340 NZ_CP033787:660253-660348 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT114340 NZ_CP033787:c660447-660383 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|