Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 2395559..2395707 | Replicon | chromosome |
Accession | NZ_CP033735 | ||
Organism | Staphylococcus cohnii strain FDAARGOS_538 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | EGX68_RS12125 | Protein ID | WP_011276848.1 |
Coordinates | 2395559..2395654 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2395672..2395707 (+) |
Genomic Context
Location: 2390915..2391373 (459 bp)
Type: Others
Protein ID: Protein_2301
Type: Others
Protein ID: Protein_2301
Location: 2391318..2391623 (306 bp)
Type: Others
Protein ID: Protein_2302
Type: Others
Protein ID: Protein_2302
Location: 2392334..2392834 (501 bp)
Type: Others
Protein ID: WP_103211460.1
Type: Others
Protein ID: WP_103211460.1
Location: 2393018..2393413 (396 bp)
Type: Others
Protein ID: WP_107556030.1
Type: Others
Protein ID: WP_107556030.1
Location: 2394130..2394543 (414 bp)
Type: Others
Protein ID: WP_070657352.1
Type: Others
Protein ID: WP_070657352.1
Location: 2394565..2395434 (870 bp)
Type: Others
Protein ID: WP_103211458.1
Type: Others
Protein ID: WP_103211458.1
Location: 2395559..2395654 (96 bp)
Type: Toxin
Protein ID: WP_011276848.1
Type: Toxin
Protein ID: WP_011276848.1
Location: 2395672..2395707 (36 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2399156..2399833 (678 bp)
Type: Others
Protein ID: WP_053025666.1
Type: Others
Protein ID: WP_053025666.1
Location: 2395836..2396654 (819 bp)
Type: Others
Protein ID: WP_046467874.1
Type: Others
Protein ID: WP_046467874.1
Location: 2396943..2398562 (1620 bp)
Type: Others
Protein ID: WP_046467873.1
Type: Others
Protein ID: WP_046467873.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EGX68_RS12090 | 2390915..2391373 | + | 459 | Protein_2301 | replication protein | - |
EGX68_RS12095 | 2391318..2391623 | + | 306 | Protein_2302 | protein rep | - |
EGX68_RS12105 | 2392334..2392834 | + | 501 | WP_103211460.1 | MepB family protein | - |
EGX68_RS12110 | 2393018..2393413 | + | 396 | WP_107556030.1 | HTH domain-containing protein | - |
EGX68_RS12115 | 2394130..2394543 | + | 414 | WP_070657352.1 | hypothetical protein | - |
EGX68_RS12120 | 2394565..2395434 | + | 870 | WP_103211458.1 | NERD domain-containing protein | - |
EGX68_RS12125 | 2395559..2395654 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2395672..2395707 | + | 36 | - | - | Antitoxin |
EGX68_RS12130 | 2395836..2396654 | - | 819 | WP_046467874.1 | aquaporin family protein | - |
EGX68_RS12135 | 2396943..2398562 | - | 1620 | WP_046467873.1 | BCCT family transporter | - |
EGX68_RS12140 | 2399156..2399833 | + | 678 | WP_053025666.1 | transglycosylase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2390190..2390864 | 674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T114180 WP_011276848.1 NZ_CP033735:2395559-2395654 [Staphylococcus cohnii]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T114180 NZ_CP033735:2395559-2395654 [Staphylococcus cohnii]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT114180 NZ_CP033735:2395672-2395707 [Staphylococcus cohnii]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |