Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 1970128..1970349 | Replicon | chromosome |
| Accession | NZ_CP033635 | ||
| Organism | Escherichia coli isolate ECCNB12-2 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | CQP61_RS12275 | Protein ID | WP_000176713.1 |
| Coordinates | 1970128..1970235 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 1970283..1970349 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CQP61_RS12250 | 1965972..1967054 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| CQP61_RS12255 | 1967054..1967887 | + | 834 | WP_000456446.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CQP61_RS12260 | 1967884..1968276 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| CQP61_RS12265 | 1968280..1969089 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| CQP61_RS12270 | 1969125..1969979 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| CQP61_RS12275 | 1970128..1970235 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1970283..1970349 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1970283..1970349 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1970285..1970348 | + | 64 | NuclAT_44 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_44 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_44 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_44 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_46 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_46 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_46 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_46 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_48 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_48 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_48 | - | - |
| - | 1970285..1970348 | + | 64 | NuclAT_48 | - | - |
| CQP61_RS12280 | 1970663..1970770 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1970823..1970884 | + | 62 | NuclAT_43 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_43 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_43 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_43 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_45 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_45 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_45 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_45 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_47 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_47 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_47 | - | - |
| - | 1970823..1970884 | + | 62 | NuclAT_47 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_13 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_13 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_13 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_13 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_15 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_15 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_15 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_15 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_17 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_17 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_17 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_17 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_19 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_19 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_19 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_19 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_21 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_21 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_21 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_21 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_23 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_23 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_23 | - | - |
| - | 1970823..1970885 | + | 63 | NuclAT_23 | - | - |
| CQP61_RS12285 | 1971176..1972276 | - | 1101 | WP_001317783.1 | sodium-potassium/proton antiporter ChaA | - |
| CQP61_RS12290 | 1972546..1972776 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| CQP61_RS12295 | 1972934..1973629 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| CQP61_RS12300 | 1973673..1974026 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T113944 WP_000176713.1 NZ_CP033635:c1970235-1970128 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T113944 NZ_CP033635:c1970235-1970128 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT113944 NZ_CP033635:1970283-1970349 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|