Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 1970128..1970349 Replicon chromosome
Accession NZ_CP033635
Organism Escherichia coli isolate ECCNB12-2

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag CQP61_RS12275 Protein ID WP_000176713.1
Coordinates 1970128..1970235 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 1970283..1970349 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CQP61_RS12250 1965972..1967054 + 1083 WP_000804726.1 peptide chain release factor 1 -
CQP61_RS12255 1967054..1967887 + 834 WP_000456446.1 peptide chain release factor N(5)-glutamine methyltransferase -
CQP61_RS12260 1967884..1968276 + 393 WP_000200374.1 invasion regulator SirB2 -
CQP61_RS12265 1968280..1969089 + 810 WP_001257044.1 invasion regulator SirB1 -
CQP61_RS12270 1969125..1969979 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CQP61_RS12275 1970128..1970235 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1970283..1970349 + 67 NuclAT_12 - Antitoxin
- 1970283..1970349 + 67 NuclAT_12 - Antitoxin
- 1970283..1970349 + 67 NuclAT_12 - Antitoxin
- 1970283..1970349 + 67 NuclAT_12 - Antitoxin
- 1970283..1970349 + 67 NuclAT_14 - Antitoxin
- 1970283..1970349 + 67 NuclAT_14 - Antitoxin
- 1970283..1970349 + 67 NuclAT_14 - Antitoxin
- 1970283..1970349 + 67 NuclAT_14 - Antitoxin
- 1970283..1970349 + 67 NuclAT_16 - Antitoxin
- 1970283..1970349 + 67 NuclAT_16 - Antitoxin
- 1970283..1970349 + 67 NuclAT_16 - Antitoxin
- 1970283..1970349 + 67 NuclAT_16 - Antitoxin
- 1970283..1970349 + 67 NuclAT_18 - Antitoxin
- 1970283..1970349 + 67 NuclAT_18 - Antitoxin
- 1970283..1970349 + 67 NuclAT_18 - Antitoxin
- 1970283..1970349 + 67 NuclAT_18 - Antitoxin
- 1970283..1970349 + 67 NuclAT_20 - Antitoxin
- 1970283..1970349 + 67 NuclAT_20 - Antitoxin
- 1970283..1970349 + 67 NuclAT_20 - Antitoxin
- 1970283..1970349 + 67 NuclAT_20 - Antitoxin
- 1970283..1970349 + 67 NuclAT_22 - Antitoxin
- 1970283..1970349 + 67 NuclAT_22 - Antitoxin
- 1970283..1970349 + 67 NuclAT_22 - Antitoxin
- 1970283..1970349 + 67 NuclAT_22 - Antitoxin
- 1970285..1970348 + 64 NuclAT_44 - -
- 1970285..1970348 + 64 NuclAT_44 - -
- 1970285..1970348 + 64 NuclAT_44 - -
- 1970285..1970348 + 64 NuclAT_44 - -
- 1970285..1970348 + 64 NuclAT_46 - -
- 1970285..1970348 + 64 NuclAT_46 - -
- 1970285..1970348 + 64 NuclAT_46 - -
- 1970285..1970348 + 64 NuclAT_46 - -
- 1970285..1970348 + 64 NuclAT_48 - -
- 1970285..1970348 + 64 NuclAT_48 - -
- 1970285..1970348 + 64 NuclAT_48 - -
- 1970285..1970348 + 64 NuclAT_48 - -
CQP61_RS12280 1970663..1970770 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1970823..1970884 + 62 NuclAT_43 - -
- 1970823..1970884 + 62 NuclAT_43 - -
- 1970823..1970884 + 62 NuclAT_43 - -
- 1970823..1970884 + 62 NuclAT_43 - -
- 1970823..1970884 + 62 NuclAT_45 - -
- 1970823..1970884 + 62 NuclAT_45 - -
- 1970823..1970884 + 62 NuclAT_45 - -
- 1970823..1970884 + 62 NuclAT_45 - -
- 1970823..1970884 + 62 NuclAT_47 - -
- 1970823..1970884 + 62 NuclAT_47 - -
- 1970823..1970884 + 62 NuclAT_47 - -
- 1970823..1970884 + 62 NuclAT_47 - -
- 1970823..1970885 + 63 NuclAT_13 - -
- 1970823..1970885 + 63 NuclAT_13 - -
- 1970823..1970885 + 63 NuclAT_13 - -
- 1970823..1970885 + 63 NuclAT_13 - -
- 1970823..1970885 + 63 NuclAT_15 - -
- 1970823..1970885 + 63 NuclAT_15 - -
- 1970823..1970885 + 63 NuclAT_15 - -
- 1970823..1970885 + 63 NuclAT_15 - -
- 1970823..1970885 + 63 NuclAT_17 - -
- 1970823..1970885 + 63 NuclAT_17 - -
- 1970823..1970885 + 63 NuclAT_17 - -
- 1970823..1970885 + 63 NuclAT_17 - -
- 1970823..1970885 + 63 NuclAT_19 - -
- 1970823..1970885 + 63 NuclAT_19 - -
- 1970823..1970885 + 63 NuclAT_19 - -
- 1970823..1970885 + 63 NuclAT_19 - -
- 1970823..1970885 + 63 NuclAT_21 - -
- 1970823..1970885 + 63 NuclAT_21 - -
- 1970823..1970885 + 63 NuclAT_21 - -
- 1970823..1970885 + 63 NuclAT_21 - -
- 1970823..1970885 + 63 NuclAT_23 - -
- 1970823..1970885 + 63 NuclAT_23 - -
- 1970823..1970885 + 63 NuclAT_23 - -
- 1970823..1970885 + 63 NuclAT_23 - -
CQP61_RS12285 1971176..1972276 - 1101 WP_001317783.1 sodium-potassium/proton antiporter ChaA -
CQP61_RS12290 1972546..1972776 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CQP61_RS12295 1972934..1973629 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
CQP61_RS12300 1973673..1974026 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T113944 WP_000176713.1 NZ_CP033635:c1970235-1970128 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T113944 NZ_CP033635:c1970235-1970128 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT113944 NZ_CP033635:1970283-1970349 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References