Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 50912..51182 | Replicon | plasmid pTB-nb3 |
Accession | NZ_CP033634 | ||
Organism | Escherichia coli isolate ECCNB12-2 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CQP61_RS02295 | Protein ID | WP_001312861.1 |
Coordinates | 51024..51182 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 50912..50975 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CQP61_RS31385 | 45976..46230 | + | 255 | WP_164473240.1 | hypothetical protein | - |
CQP61_RS02270 | 46701..47228 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
CQP61_RS02275 | 47284..47517 | + | 234 | WP_021534894.1 | DUF905 domain-containing protein | - |
CQP61_RS02280 | 47581..49539 | + | 1959 | WP_123891607.1 | ParB/RepB/Spo0J family partition protein | - |
CQP61_RS02285 | 49594..50028 | + | 435 | WP_123891611.1 | conjugation system SOS inhibitor PsiB | - |
CQP61_RS02290 | 50025..50744 | + | 720 | WP_086624612.1 | plasmid SOS inhibition protein A | - |
CQP61_RS31395 | 50756..50944 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 50756..50980 | + | 225 | NuclAT_0 | - | - |
- | 50756..50980 | + | 225 | NuclAT_0 | - | - |
- | 50756..50980 | + | 225 | NuclAT_0 | - | - |
- | 50756..50980 | + | 225 | NuclAT_0 | - | - |
- | 50912..50975 | - | 64 | - | - | Antitoxin |
CQP61_RS02295 | 51024..51182 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CQP61_RS31675 | 51477..51803 | + | 327 | WP_183129667.1 | hypothetical protein | - |
CQP61_RS02310 | 52123..52320 | + | 198 | WP_045174704.1 | hypothetical protein | - |
CQP61_RS02315 | 52439..53260 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CQP61_RS02320 | 53557..54147 | - | 591 | WP_165850686.1 | transglycosylase SLT domain-containing protein | - |
CQP61_RS02325 | 54490..54873 | + | 384 | WP_001151565.1 | relaxosome protein TraM | - |
CQP61_RS02330 | 55067..55753 | + | 687 | WP_072649631.1 | PAS domain-containing protein | - |
CQP61_RS02335 | 55847..56074 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..82252 | 82252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T113936 WP_001312861.1 NZ_CP033634:51024-51182 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T113936 NZ_CP033634:51024-51182 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT113936 NZ_CP033634:c50975-50912 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|