Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 26678..26947 | Replicon | plasmid unnamed4 |
Accession | NZ_CP033629 | ||
Organism | Klebsiella pneumoniae strain 4743 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | DPQ49_RS30840 | Protein ID | WP_001312861.1 |
Coordinates | 26789..26947 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 26678..26743 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DPQ49_RS29300 | 22388..22915 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
DPQ49_RS29305 | 22973..23206 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
DPQ49_RS29310 | 23267..25290 | + | 2024 | Protein_32 | ParB/RepB/Spo0J family partition protein | - |
DPQ49_RS29315 | 25359..25793 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
DPQ49_RS29320 | 25790..26509 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 26521..26745 | + | 225 | NuclAT_0 | - | - |
- | 26521..26745 | + | 225 | NuclAT_0 | - | - |
- | 26521..26745 | + | 225 | NuclAT_0 | - | - |
- | 26521..26745 | + | 225 | NuclAT_0 | - | - |
- | 26678..26743 | + | 66 | - | - | Antitoxin |
DPQ49_RS30840 | 26789..26947 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DPQ49_RS30995 | 27185..27562 | - | 378 | Protein_36 | hypothetical protein | - |
DPQ49_RS29345 | 27862..28158 | + | 297 | WP_001272251.1 | hypothetical protein | - |
DPQ49_RS29350 | 28269..29090 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
DPQ49_RS29355 | 29387..29989 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
DPQ49_RS29365 | 30312..30695 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
DPQ49_RS29370 | 30889..31560 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
DPQ49_RS29375 | 31697..31924 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / blaCTX-M-15 | - | 1..67867 | 67867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T113904 WP_001312861.1 NZ_CP033629:26789-26947 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T113904 NZ_CP033629:26789-26947 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT113904 NZ_CP033629:26678-26743 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|