Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4379907..4380132 | Replicon | chromosome |
| Accession | NZ_CP033510 | ||
| Organism | Shigella flexneri strain 2016AM-0877 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | EEL47_RS22255 | Protein ID | WP_000813254.1 |
| Coordinates | 4379977..4380132 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4379907..4379965 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EEL47_RS26465 | 4375905..4376074 | + | 170 | Protein_4238 | hypothetical protein | - |
| EEL47_RS22220 | 4376220..4376966 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
| EEL47_RS22225 | 4376981..4377403 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
| EEL47_RS22230 | 4377461..4377817 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| EEL47_RS22235 | 4377910..4378128 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| EEL47_RS22240 | 4378130..4378495 | + | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
| EEL47_RS22245 | 4378492..4379157 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| EEL47_RS22250 | 4379157..4379522 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 4379907..4379965 | - | 59 | - | - | Antitoxin |
| EEL47_RS22255 | 4379977..4380132 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| EEL47_RS22270 | 4381469..4382068 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| EEL47_RS22275 | 4382068..4382358 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| EEL47_RS22280 | 4382355..4382909 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
| EEL47_RS22285 | 4383062..4383235 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| EEL47_RS22290 | 4383297..4384436 | + | 1140 | WP_000088354.1 | IS3 family transposase | - |
| EEL47_RS22295 | 4384507..4384989 | + | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 4371990..4436136 | 64146 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T113786 WP_000813254.1 NZ_CP033510:4379977-4380132 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T113786 NZ_CP033510:4379977-4380132 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT113786 NZ_CP033510:c4379965-4379907 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|