Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 323259..323484 | Replicon | chromosome |
| Accession | NZ_CP033510 | ||
| Organism | Shigella flexneri strain 2016AM-0877 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | EEL47_RS01855 | Protein ID | WP_000813254.1 |
| Coordinates | 323259..323414 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 323426..323484 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EEL47_RS01795 | 318678..319028 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| EEL47_RS01800 | 319025..319522 | + | 498 | Protein_339 | IS66 family transposase zinc-finger binding domain-containing protein | - |
| EEL47_RS01805 | 319578..320275 | + | 698 | WP_223368647.1 | IS1 family transposase | - |
| EEL47_RS01830 | 320702..321390 | - | 689 | Protein_341 | bacteriophage antitermination protein Q | - |
| EEL47_RS01835 | 321387..321752 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EEL47_RS01840 | 321753..322811 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| EEL47_RS01845 | 322813..323091 | - | 279 | WP_011069426.1 | hypothetical protein | - |
| EEL47_RS01855 | 323259..323414 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 323426..323484 | + | 59 | - | - | Antitoxin |
| EEL47_RS01870 | 324066..324482 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| EEL47_RS01875 | 324509..324649 | + | 141 | Protein_347 | DUF4224 domain-containing protein | - |
| EEL47_RS01880 | 324649..325699 | + | 1051 | Protein_348 | tyrosine-type recombinase/integrase | - |
| EEL47_RS01890 | 325910..326707 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| EEL47_RS01900 | 327045..328307 | + | 1263 | Protein_350 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 312019..360044 | 48025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T113775 WP_000813254.1 NZ_CP033510:c323414-323259 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T113775 NZ_CP033510:c323414-323259 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT113775 NZ_CP033510:323426-323484 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|