Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 39794..40064 | Replicon | plasmid pKPC2_115069 |
Accession | NZ_CP033404 | ||
Organism | Klebsiella pneumoniae strain WCHKP115069 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | DVJ73_RS29880 | Protein ID | WP_001312861.1 |
Coordinates | 39906..40064 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 39794..39857 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DVJ73_RS01650 | 35505..36032 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
DVJ73_RS01655 | 36090..36323 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
DVJ73_RS01660 | 36384..38407 | + | 2024 | Protein_47 | ParB/RepB/Spo0J family partition protein | - |
DVJ73_RS01665 | 38476..38910 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
DVJ73_RS01670 | 38907..39626 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 39638..39862 | + | 225 | NuclAT_0 | - | - |
- | 39638..39862 | + | 225 | NuclAT_0 | - | - |
- | 39638..39862 | + | 225 | NuclAT_0 | - | - |
- | 39638..39862 | + | 225 | NuclAT_0 | - | - |
- | 39794..39857 | - | 64 | - | - | Antitoxin |
DVJ73_RS29880 | 39906..40064 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DVJ73_RS31155 | 40302..40679 | - | 378 | Protein_51 | hypothetical protein | - |
DVJ73_RS01695 | 40979..41275 | + | 297 | WP_001272251.1 | hypothetical protein | - |
DVJ73_RS01700 | 41386..42207 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
DVJ73_RS01705 | 42504..43151 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
DVJ73_RS01710 | 43428..43811 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
DVJ73_RS01715 | 44002..44688 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
DVJ73_RS01720 | 44782..45009 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..154986 | 154986 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T113661 WP_001312861.1 NZ_CP033404:39906-40064 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T113661 NZ_CP033404:39906-40064 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT113661 NZ_CP033404:c39857-39794 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|