Detailed information of TA system TA113607

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 10500..10753
• Replicon: plasmid pCTXM65_015625
• Accession: NZ_CP033394
• Organism: Klebsiella pneumoniae strain 015625

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: DCD52_RS00220
• Protein ID: WP_001312851.1
• Coordinates: 10604..10753 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	10500..10559 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DCD52_RS00175	5876..6223	+	348	Protein_6	recombinase family protein	-
DCD52_RS00180	6278..6982	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
DCD52_RS00185	7046..7207	+	162	Protein_8	DNA helicase	-
DCD52_RS00190	7227..7973	+	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
DCD52_RS00195	8028..8588	+	561	WP_000139328.1	fertility inhibition protein FinO	-
DCD52_RS00200	8720..8920	+	201	WP_015059022.1	hypothetical protein	-
DCD52_RS00205	9306..9905	+	600	WP_032083981.1	hypothetical protein	-
DCD52_RS00210	10069..10299	+	231	WP_001736714.1	hypothetical protein	-
-	10500..10559	-	60	NuclAT_0	-	Antitoxin
-	10500..10559	-	60	NuclAT_0	-	Antitoxin
-	10500..10559	-	60	NuclAT_0	-	Antitoxin
-	10500..10559	-	60	NuclAT_0	-	Antitoxin
DCD52_RS00220	10604..10753	+	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
DCD52_RS00225	11037..11285	+	249	WP_000083837.1	replication regulatory protein RepA	-
DCD52_RS00235	11530..11604	+	75	WP_001375168.1	RepA leader peptide Tap	-
DCD52_RS00240	11597..12454	+	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
DCD52_RS00250	13393..14046	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
DCD52_RS00255	14139..14396	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
DCD52_RS00260	14329..14730	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
DCD52_RS00265	14979..15394	+	416	Protein_21	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-65 / catA2 / blaKPC-12 / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / blaTEM-1C / tet(A)	-	1..142207	142207

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T113607 WP_001312851.1 NZ_CP033394:10604-10753 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T113607 NZ_CP033394:10604-10753 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT113607 NZ_CP033394:c10559-10500 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin