Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2548548..2548732 | Replicon | chromosome |
Accession | NZ_CP033114 | ||
Organism | Staphylococcus aureus strain ST20130945 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAST45_RS12640 | Protein ID | WP_000482647.1 |
Coordinates | 2548625..2548732 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2548548..2548608 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST45_RS12625 | 2544058..2544225 | - | 168 | Protein_2439 | hypothetical protein | - |
SAST45_RS12630 | 2544456..2546189 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
SAST45_RS12635 | 2546214..2547977 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2548548..2548608 | + | 61 | - | - | Antitoxin |
SAST45_RS12640 | 2548625..2548732 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAST45_RS12645 | 2548866..2549252 | - | 387 | WP_000779351.1 | flippase GtxA | - |
SAST45_RS12650 | 2549520..2550662 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
SAST45_RS12655 | 2550722..2551381 | + | 660 | WP_000831298.1 | membrane protein | - |
SAST45_RS12660 | 2551563..2552774 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
SAST45_RS12665 | 2552897..2553370 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T113220 WP_000482647.1 NZ_CP033114:c2548732-2548625 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T113220 NZ_CP033114:c2548732-2548625 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT113220 NZ_CP033114:2548548-2548608 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|