Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2260125..2260341 | Replicon | chromosome |
Accession | NZ_CP033114 | ||
Organism | Staphylococcus aureus strain ST20130945 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | SAST45_RS11150 | Protein ID | WP_073392962.1 |
Coordinates | 2260237..2260341 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2260125..2260180 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST45_RS11130 | 2255218..2255538 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAST45_RS11135 | 2255540..2256520 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
SAST45_RS11140 | 2256786..2257877 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
SAST45_RS11145 | 2258165..2259811 | + | 1647 | WP_000277709.1 | IS1182-like element ISSau3 family transposase | - |
- | 2260125..2260180 | + | 56 | - | - | Antitoxin |
SAST45_RS11150 | 2260237..2260341 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
SAST45_RS11155 | 2261021..2261179 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAST45_RS11160 | 2261838..2262695 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
SAST45_RS11165 | 2262763..2263545 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2258165..2259811 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T113217 WP_073392962.1 NZ_CP033114:c2260341-2260237 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T113217 NZ_CP033114:c2260341-2260237 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT113217 NZ_CP033114:2260125-2260180 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|