Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2069488..2069787 | Replicon | chromosome |
| Accession | NZ_CP033114 | ||
| Organism | Staphylococcus aureus strain ST20130945 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | SAST45_RS10060 | Protein ID | WP_011447039.1 |
| Coordinates | 2069611..2069787 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2069488..2069543 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAST45_RS10020 | 2064818..2065078 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| SAST45_RS10025 | 2065131..2065481 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAST45_RS10030 | 2066167..2066616 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| SAST45_RS10035 | 2066711..2067046 | - | 336 | Protein_1933 | SH3 domain-containing protein | - |
| SAST45_RS10040 | 2067696..2068187 | - | 492 | WP_000919350.1 | staphylokinase | - |
| SAST45_RS10045 | 2068378..2069133 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAST45_RS10050 | 2069145..2069399 | - | 255 | WP_000611512.1 | phage holin | - |
| SAST45_RS10055 | 2069451..2069558 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2069480..2069619 | + | 140 | NuclAT_0 | - | - |
| - | 2069480..2069619 | + | 140 | NuclAT_0 | - | - |
| - | 2069480..2069619 | + | 140 | NuclAT_0 | - | - |
| - | 2069480..2069619 | + | 140 | NuclAT_0 | - | - |
| - | 2069488..2069543 | + | 56 | - | - | Antitoxin |
| SAST45_RS10060 | 2069611..2069787 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| SAST45_RS10065 | 2069896..2070669 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| SAST45_RS10070 | 2071090..2071464 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| SAST45_RS10075 | 2071520..2071807 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| SAST45_RS10080 | 2071854..2072006 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / tsst-1 / groEL | 2059356..2136075 | 76719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T113212 WP_011447039.1 NZ_CP033114:c2069787-2069611 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T113212 NZ_CP033114:c2069787-2069611 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT113212 NZ_CP033114:2069488-2069543 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|