Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1898730..1898910 | Replicon | chromosome |
Accession | NZ_CP033114 | ||
Organism | Staphylococcus aureus strain ST20130945 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAST45_RS09015 | Protein ID | WP_001801861.1 |
Coordinates | 1898730..1898825 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1898853..1898910 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST45_RS08985 | 1893874..1894500 | + | 627 | WP_000669038.1 | hypothetical protein | - |
SAST45_RS08990 | 1894541..1894885 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
SAST45_RS08995 | 1894983..1895555 | + | 573 | WP_000414222.1 | hypothetical protein | - |
SAST45_RS09000 | 1895704..1897071 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
SAST45_RS09005 | 1897071..1897640 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAST45_RS09010 | 1897833..1898279 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
SAST45_RS09015 | 1898730..1898825 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1898853..1898910 | - | 58 | - | - | Antitoxin |
SAST45_RS09020 | 1898948..1899049 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAST45_RS09025 | 1899224..1899667 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
SAST45_RS09030 | 1899667..1900110 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
SAST45_RS09035 | 1900110..1900552 | - | 443 | Protein_1771 | DUF1433 domain-containing protein | - |
SAST45_RS09040 | 1901077..1903497 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | hysA | 1887891..1934973 | 47082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T113208 WP_001801861.1 NZ_CP033114:1898730-1898825 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T113208 NZ_CP033114:1898730-1898825 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT113208 NZ_CP033114:c1898910-1898853 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|